PDB entry 1oai

View 1oai on RCSB PDB site
Description: complex between tap uba domain and fxfg nucleoporin peptide
Deposited on 2003-01-14, released 2003-02-20
The last revision prior to the SCOP 1.63 freeze date was dated 2003-02-20, with a file datestamp of 2003-02-20.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.149
AEROSPACI score: 1.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1oaia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oaiA (A:)
    ptlspeqqemlqafstqsgmnlewsqkclqdnnwdytrsaqafthlkakgeipevafmk