PDB entry 1oah

View 1oah on RCSB PDB site
Description: cytochrome c nitrite reductase from desulfovibrio desulfuricans atcc 27774: the relevance of the two calcium sites in the structure of the catalytic subunit (nrfa).
Deposited on 2003-01-14, released 2003-05-08
The last revision prior to the SCOP 1.69 freeze date was dated 2003-05-08, with a file datestamp of 2003-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.189
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1oaha_
  • Chain 'B':
    Domains in SCOP 1.69: d1oahb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oahA (A:)
    mnkrivttalalatllgvallsgcqdvstelkapkyktgiaetetkmsafkgqfpqqyas
    ymknnedrimtdykgsvpyhkndnvnplpkgfkhaqpylknlwlgypfmyeynetrghty
    aiddflnidrinrfaadgkgnlpatcwncktpkmmewvsqygdkfwsmdvnefrakdkin
    ahdetigcanchdpatmelrlyseplkdwlkrsgkdwqkmsrnekrtlvcaqchveyyft
    hkdngpaakpvfpwdngfnpedmyqyykghgakgpdgkpgpfvdwvhaaskvpmikmqhp
    eyetfqdgphgaagvscadchmqyvredgkkisshwmtspmkdpemracrqchadktgey
    lrqrvlytqqktfdqllkaqemsvkaheavrlanayeghraanyealmaearemvrkgql
    fwdyvsaensvgfhnpakaldtlmtsmecsqkavdlateatdfgiapalagdikklvppi
    ltlsrklqqdpeflkqnpwtrllpalpkaeqvwegqdra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oahA (A:)
    tgiaetetkmsafkgqfpqqyasymknnedrimtdykgsvpyhkndnvnplpkgfkhaqp
    ylknlwlgypfmyeynetrghtyaiddflnidrinrfaadgkgnlpatcwncktpkmmew
    vsqygdkfwsmdvnefrakdkinahdetigcanchdpatmelrlyseplkdwlkrsgkdw
    qkmsrnekrtlvcaqchveyyfthkdngpaakpvfpwdngfnpedmyqyykghgakgpdg
    kpgpfvdwvhaaskvpmikmqhpeyetfqdgphgaagvscadchmqyisshwmtspmkdp
    emracrqchadktgeylrqrvlytqqktfdqllkaqemsvkaheavrlanayeghraany
    ealmaearemvrkgqlfwdyvsaensvgfhnpakaldtlmtsmecsqkavdlateatdfg
    iapalagdikklvppiltlsrklqqdpeflkqnpwtrllpalpkaeqvwegqdra
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oahB (B:)
    mnkrivttalalatllgvallsgcqdvstelkapkyktgiaetetkmsafkgqfpqqyas
    ymknnedrimtdykgsvpyhkndnvnplpkgfkhaqpylknlwlgypfmyeynetrghty
    aiddflnidrinrfaadgkgnlpatcwncktpkmmewvsqygdkfwsmdvnefrakdkin
    ahdetigcanchdpatmelrlyseplkdwlkrsgkdwqkmsrnekrtlvcaqchveyyft
    hkdngpaakpvfpwdngfnpedmyqyykghgakgpdgkpgpfvdwvhaaskvpmikmqhp
    eyetfqdgphgaagvscadchmqyvredgkkisshwmtspmkdpemracrqchadktgey
    lrqrvlytqqktfdqllkaqemsvkaheavrlanayeghraanyealmaearemvrkgql
    fwdyvsaensvgfhnpakaldtlmtsmecsqkavdlateatdfgiapalagdikklvppi
    ltlsrklqqdpeflkqnpwtrllpalpkaeqvwegqdra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oahB (B:)
    tgiaetetkmsafkgqfpqqyasymknnedrimtdykgsvpyhkndnvnplpkgfkhaqp
    ylknlwlgypfmyeynetrghtyaiddflnidrinrfaadgkgnlpatcwncktpkmmew
    vsqygdkfwsmdvnefrakdkinahdetigcanchdpatmelrlyseplkdwlkrsgkdw
    qkmsrnekrtlvcaqchveyyfthkdngpaakpvfpwdngfnpedmyqyykghgakgpdg
    kpgpfvdwvhaaskvpmikmqhpeyetfqdgphgaagvscadchmqyvredgkkisshwm
    tspmkdpemracrqchadktgeylrqrvlytqqktfdqllkaqemsvkaheavrlanaye
    ghraanyealmaearemvrkgqlfwdyvsaensvgfhnpakaldtlmtsmecsqkavdla
    teatdfgiapalagdikklvppiltlsrklqqdpeflkqnpwtrllpalpkaeqvwegqd
    ra