PDB entry 1oah

View 1oah on RCSB PDB site
Description: cytochrome c nitrite reductase from desulfovibrio desulfuricans atcc 27774: the relevance of the two calcium sites in the structure of the catalytic subunit (nrfa).
Class: reductase
Keywords: reductase, cytochrome c, nitrite reductase, nitrogen cycle, respiratory nitrite ammonification
Deposited on 2003-01-14, released 2003-05-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.189
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c nitrite reductase
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VNU2 (Start-513)
    • PDB 1OAH (514-518)
    Domains in SCOPe 2.07: d1oaha_
  • Chain 'B':
    Compound: cytochrome c nitrite reductase
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VNU2 (Start-513)
    • PDB 1OAH (514-518)
    Domains in SCOPe 2.07: d1oahb_
  • Heterogens: HEM, CA, CL, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oahA (A:)
    mnkrivttalalatllgvallsgcqdvstelkapkyktgiaetetkmsafkgqfpqqyas
    ymknnedrimtdykgsvpyhkndnvnplpkgfkhaqpylknlwlgypfmyeynetrghty
    aiddflnidrinrfaadgkgnlpatcwncktpkmmewvsqygdkfwsmdvnefrakdkin
    ahdetigcanchdpatmelrlyseplkdwlkrsgkdwqkmsrnekrtlvcaqchveyyft
    hkdngpaakpvfpwdngfnpedmyqyykghgakgpdgkpgpfvdwvhaaskvpmikmqhp
    eyetfqdgphgaagvscadchmqyvredgkkisshwmtspmkdpemracrqchadktgey
    lrqrvlytqqktfdqllkaqemsvkaheavrlanayeghraanyealmaearemvrkgql
    fwdyvsaensvgfhnpakaldtlmtsmecsqkavdlateatdfgiapalagdikklvppi
    ltlsrklqqdpeflkqnpwtrllpalpkaeqvwegqdra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oahA (A:)
    tgiaetetkmsafkgqfpqqyasymknnedrimtdykgsvpyhkndnvnplpkgfkhaqp
    ylknlwlgypfmyeynetrghtyaiddflnidrinrfaadgkgnlpatcwncktpkmmew
    vsqygdkfwsmdvnefrakdkinahdetigcanchdpatmelrlyseplkdwlkrsgkdw
    qkmsrnekrtlvcaqchveyyfthkdngpaakpvfpwdngfnpedmyqyykghgakgpdg
    kpgpfvdwvhaaskvpmikmqhpeyetfqdgphgaagvscadchmqyisshwmtspmkdp
    emracrqchadktgeylrqrvlytqqktfdqllkaqemsvkaheavrlanayeghraany
    ealmaearemvrkgqlfwdyvsaensvgfhnpakaldtlmtsmecsqkavdlateatdfg
    iapalagdikklvppiltlsrklqqdpeflkqnpwtrllpalpkaeqvwegqdra
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oahB (B:)
    mnkrivttalalatllgvallsgcqdvstelkapkyktgiaetetkmsafkgqfpqqyas
    ymknnedrimtdykgsvpyhkndnvnplpkgfkhaqpylknlwlgypfmyeynetrghty
    aiddflnidrinrfaadgkgnlpatcwncktpkmmewvsqygdkfwsmdvnefrakdkin
    ahdetigcanchdpatmelrlyseplkdwlkrsgkdwqkmsrnekrtlvcaqchveyyft
    hkdngpaakpvfpwdngfnpedmyqyykghgakgpdgkpgpfvdwvhaaskvpmikmqhp
    eyetfqdgphgaagvscadchmqyvredgkkisshwmtspmkdpemracrqchadktgey
    lrqrvlytqqktfdqllkaqemsvkaheavrlanayeghraanyealmaearemvrkgql
    fwdyvsaensvgfhnpakaldtlmtsmecsqkavdlateatdfgiapalagdikklvppi
    ltlsrklqqdpeflkqnpwtrllpalpkaeqvwegqdra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oahB (B:)
    tgiaetetkmsafkgqfpqqyasymknnedrimtdykgsvpyhkndnvnplpkgfkhaqp
    ylknlwlgypfmyeynetrghtyaiddflnidrinrfaadgkgnlpatcwncktpkmmew
    vsqygdkfwsmdvnefrakdkinahdetigcanchdpatmelrlyseplkdwlkrsgkdw
    qkmsrnekrtlvcaqchveyyfthkdngpaakpvfpwdngfnpedmyqyykghgakgpdg
    kpgpfvdwvhaaskvpmikmqhpeyetfqdgphgaagvscadchmqyvredgkkisshwm
    tspmkdpemracrqchadktgeylrqrvlytqqktfdqllkaqemsvkaheavrlanaye
    ghraanyealmaearemvrkgqlfwdyvsaensvgfhnpakaldtlmtsmecsqkavdla
    teatdfgiapalagdikklvppiltlsrklqqdpeflkqnpwtrllpalpkaeqvwegqd
    ra