PDB entry 1oac

View 1oac on RCSB PDB site
Description: crystal structure of a quinoenzyme: copper amine oxidase of escherichia coli at 2 angstroems resolution
Class: oxidoreductase
Keywords: oxidoreductase, copper, tpq, periplasmic, signal
Deposited on 1995-09-27, released 1996-04-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.162
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: copper amine oxidase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46883
      • conflict (465)
    Domains in SCOPe 2.06: d1oaca1, d1oaca2, d1oaca3, d1oaca4
  • Chain 'B':
    Compound: copper amine oxidase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46883 (Start-726)
      • conflict (465)
    Domains in SCOPe 2.06: d1oacb1, d1oacb2, d1oacb3, d1oacb4
  • Heterogens: CU, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oacA (A:)
    hggeahmvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvp
    vvmkdnkawvsdtfindvfqsgldqtfqvekrphplnaltadeikqaveivkasadfkpn
    trfteisllppdkeavwafalenkpvdqprkadvimldgkhiieavvdlqnnkllswqpi
    kdahgmvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqda
    rllkvisyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrva
    pavkpmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyeg
    slggmivpygdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvp
    meipraiavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengti
    gidagatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgen
    nslvamdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnp
    vsyqiipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsth
    dtglgqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptl
    galkkdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oacA (A:)
    ahmvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmk
    dnkawvsdtfindvfqsgldqtfqvekrphplnaltadeikqaveivkasadfkpntrft
    eisllppdkeavwafalenkpvdqprkadvimldgkhiieavvdlqnnkllswqpikdah
    gmvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqdarllk
    visyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrvapavk
    pmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyegslgg
    mivpygdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvpmeip
    raiavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengtigida
    gatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgennslv
    amdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnpvsyq
    iipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsthdtgl
    gqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptlgalk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oacB (B:)
    hggeahmvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvp
    vvmkdnkawvsdtfindvfqsgldqtfqvekrphplnaltadeikqaveivkasadfkpn
    trfteisllppdkeavwafalenkpvdqprkadvimldgkhiieavvdlqnnkllswqpi
    kdahgmvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqda
    rllkvisyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrva
    pavkpmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyeg
    slggmivpygdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvp
    meipraiavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengti
    gidagatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgen
    nslvamdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnp
    vsyqiipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsth
    dtglgqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptl
    galkkdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oacB (B:)
    ahmvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmk
    dnkawvsdtfindvfqsgldqtfqvekrphplnaltadeikqaveivkasadfkpntrft
    eisllppdkeavwafalenkpvdqprkadvimldgkhiieavvdlqnnkllswqpikdah
    gmvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqdarllk
    visyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrvapavk
    pmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyegslgg
    mivpygdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvpmeip
    raiavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengtigida
    gatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgennslv
    amdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnpvsyq
    iipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsthdtgl
    gqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptlgalk
    kdk