PDB entry 1oac

View 1oac on RCSB PDB site
Description: crystal structure of a quinoenzyme: copper amine oxidase of escherichia coli at 2 angstroems resolution
Deposited on 1995-09-27, released 1996-04-03
The last revision prior to the SCOP 1.55 freeze date was dated 1996-04-03, with a file datestamp of 1996-04-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.162
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oacA (A:)
    ahmvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmk
    dnkawvsdtfindvfqsgldqtfqvekrphplnaltadeikqaveivkasadfkpntrft
    eisllppdkeavwafalenkpvdqprkadvimldgkhiieavvdlqnnkllswqpikdah
    gmvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqdarllk
    visyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrvapavk
    pmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyegslgg
    mivpygdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvpmeip
    raiavferyagpeykhqemgqpnvsterrelvvrwistvgnadyifdwifhengtigida
    gatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgennslv
    amdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnpvsyq
    iipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsthdtgl
    gqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptlgalk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oacB (B:)
    ahmvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmk
    dnkawvsdtfindvfqsgldqtfqvekrphplnaltadeikqaveivkasadfkpntrft
    eisllppdkeavwafalenkpvdqprkadvimldgkhiieavvdlqnnkllswqpikdah
    gmvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqdarllk
    visyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrvapavk
    pmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyegslgg
    mivpygdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvpmeip
    raiavferyagpeykhqemgqpnvsterrelvvrwistvgnadyifdwifhengtigida
    gatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgennslv
    amdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnpvsyq
    iipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsthdtgl
    gqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptlgalk
    kdk