PDB entry 1oab

View 1oab on RCSB PDB site
Description: crystal structure of the tyrosine regulated 3-deoxy-d-arabino-heptulosonate-7-phosphate synthase from saccharomyces cerevisiae in complex with phosphoenolpyruvate and manganese(II)
Class: lyase
Keywords: beta-alpha-barrel, lyase, synthase
Deposited on 2003-01-06, released 2004-01-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.162
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosine-regulated 3-deoxy-d-arabino-heptulosonate-7-phosphate synthase
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1oaba_
  • Chain 'B':
    Compound: tyrosine-regulated 3-deoxy-d-arabino-heptulosonate-7-phosphate synthase
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1oabb_
  • Heterogens: MN, PEP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oabA (A:)
    msespmfaangmpkvnqgaeedvrilgydplaspallqvqipatptsletakrgrreaid
    iitgkddrvlvivgpcsihdleaaqeyalrlkklsdelkgdlsiimraylekprttvgwk
    glindpdvnntfninkglqsarqlfvnltniglpigsemldtispqyladlvsfgaigar
    ttesqlhrelasglsfpvgfkngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkg
    nehcfvilrggkkgtnydaksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvc
    eqiangenaitgvmiesninegnqgipaegkaglkygvsitdacigwettedvlrklaaa
    vrqrrevnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oabA (A:)
    vrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcsihdle
    aaqeyalrlkklsdelkgdlsiimraylekprttvgwkglindpdvnntfninkglqsar
    qlfvnltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvgfkn
    gtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkgnehcfvilrggkkgtnydaksv
    aeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvceqiangenaitgvmiesnineg
    nqgipaglkygvsitdacigwettedvlrklaaavrqrrevnk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oabB (B:)
    msespmfaangmpkvnqgaeedvrilgydplaspallqvqipatptsletakrgrreaid
    iitgkddrvlvivgpcsihdleaaqeyalrlkklsdelkgdlsiimraylekprttvgwk
    glindpdvnntfninkglqsarqlfvnltniglpigsemldtispqyladlvsfgaigar
    ttesqlhrelasglsfpvgfkngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkg
    nehcfvilrggkkgtnydaksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvc
    eqiangenaitgvmiesninegnqgipaegkaglkygvsitdacigwettedvlrklaaa
    vrqrrevnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oabB (B:)
    vrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcsihdle
    aaqeyalrlkklsdelkgdlsiimraylekprttvgwkglindpdvnntfninkglqsar
    qlfvnltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvgfkn
    gtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkgnehcfvilrggkkgtnydaksv
    aeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvceqiangenaitgvmiesnineg
    nqgikygvsitdacigwettedvlrklaaavrqrrevnk