PDB entry 1oaa

View 1oaa on RCSB PDB site
Description: mouse sepiapterin reductase complexed with nadp and oxaloacetate
Deposited on 1997-08-25, released 1999-02-16
The last revision prior to the SCOP 1.55 freeze date was dated 1999-02-16, with a file datestamp of 1999-02-16.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.2
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1oaa__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oaa_ (-)
    adglgcavcvltgasrgfgralapqlarllspgsvmlvsarsesmlrqlkeelgaqqpdl
    kvvlaaadlgteagvqrllsavrelprpeglqrlllinnaatlgdvskgflnvndlaevn
    nywalnltsmlcltsgtlnafqdspglsktvvnisslcalqpykgwglycagkaardmly
    qvlaaeepsvrvlsyapgpldndmqqlaretskdpelrsklqklksdgalvdcgtsaqkl
    lgllqkdtfqsgahvdfyd