PDB entry 1oa8

View 1oa8 on RCSB PDB site
Description: AXH domain of human spinocerebellar ataxin-1
Class: RNA binding
Keywords: RNA binding, high mobility group homology, hmg, RNA-binding, dimerization
Deposited on 2003-01-02, released 2003-11-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-09, with a file datestamp of 2019-10-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ataxin-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OA8 (0-0)
    • Uniprot P54253 (1-End)
    Domains in SCOPe 2.08: d1oa8a_
  • Chain 'B':
    Compound: ataxin-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OA8 (0-0)
    • Uniprot P54253 (1-End)
    Domains in SCOPe 2.08: d1oa8b_
  • Chain 'C':
    Compound: ataxin-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OA8 (0-0)
    • Uniprot P54253 (1-End)
    Domains in SCOPe 2.08: d1oa8c_
  • Chain 'D':
    Compound: ataxin-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OA8 (0-0)
    • Uniprot P54253 (1-132)
    Domains in SCOPe 2.08: d1oa8d_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oa8A (A:)
    gspaaapptlppyfmkgsiiqlangelkkvedlktedfiqsaeisndlkidsstveried
    shspgvaviqfavgehraqvsvevlveypffvfgqgwssccpertsqlfdlpcsklsvgd
    vcisltlknlkng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oa8A (A:)
    gspaaapptlppyfmkgsiiqlangelkkvedlktedfiqsaeisndlkidsstveried
    shspgvaviqfavgehraqvsvevlveypffvfgqgwssccpertsqlfdlpcsklsvgd
    vcisltlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oa8B (B:)
    gspaaapptlppyfmkgsiiqlangelkkvedlktedfiqsaeisndlkidsstveried
    shspgvaviqfavgehraqvsvevlveypffvfgqgwssccpertsqlfdlpcsklsvgd
    vcisltlknlkng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oa8B (B:)
    gspaaapptlppyfmkgsiiqlangelkkvedlktedfiqsaeisndlkidsstveried
    shspgvaviqfavgehraqvsvevlveypffvfgqgwssccpertsqlfdlpcsklsvgd
    vcisltlk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1oa8C (C:)
    gspaaapptlppyfmkgsiiqlangelkkvedlktedfiqsaeisndlkidsstveried
    shspgvaviqfavgehraqvsvevlveypffvfgqgwssccpertsqlfdlpcsklsvgd
    vcisltlknlkng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oa8C (C:)
    gspaaapptlppyfmkgsiiqlangelkkvedlktedfiqsaeisndlkidsstveried
    shspgvaviqfavgehraqvsvevlveypffvfgqgwssccpertsqlfdlpcsklsvgd
    vcisltlkn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oa8D (D:)
    gspaaapptlppyfmkgsiiqlangelkkvedlktedfiqsaeisndlkidsstveried
    shspgvaviqfavgehraqvsvevlveypffvfgqgwssccpertsqlfdlpcsklsvgd
    vcisltlknlkng