PDB entry 1oa4

View 1oa4 on RCSB PDB site
Description: comparison of family 12 glycoside hydrolases and recruited substitutions important for thermal stability
Class: hydrolase
Keywords: hydrolase, cellulase, cellulose degradation, endoglucanase, glycosyl hydrolase, gh family 12, streptomyces sp 11ag8 cel12a
Deposited on 2002-12-28, released 2003-03-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.18185
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: endo-beta-1,4-glucanase
  Species: STREPTOMYCES SP. 11AG8 [TaxId:133452]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9KIH1 (0-221)
  Domains in SCOPe 2.08: d1oa4a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1oa4A (A:)
  nqqicdrygtttiqdryvvqnnrwgtsatqcinvtgngfeitqadgsvptngapksypsv
  ydgchygncaprttlpmrissigsapssvsyrytgngvynaaydiwldptprtngvnrte
  imiwfnrvgpvqpigspvgtahvggrswevwtgsngsndvisflapsaisswsfdvkdfv
  dqavshglatpdwyltsiqagfepweggtglavnsfssavna