PDB entry 1o9s

View 1o9s on RCSB PDB site
Description: crystal structure of a ternary complex of the human histone methyltransferase set7/9
Deposited on 2002-12-18, released 2003-02-06
The last revision prior to the SCOP 1.69 freeze date was dated 2003-09-11, with a file datestamp of 2003-09-11.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.206
AEROSPACI score: -1.52 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o9sA (A:)
    gqykdnirhgvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemieg
    klatlmsteegrphfelmpgnsvyhfdkstsscistnallpdpyeservyvaeslissag
    eglfskvavgpntvmsfyngvrithqevdsrdwalngntlsldeetvidvpepynhvsky
    caslghkanhsftpnciydmfvhprfgpikcirtlraveadeeltvaygydhsppgksgp
    eapewyqvelkafqatqqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o9sA (A:)
    gvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklatlmste
    egrphfelmpgnsvyhfdkstsscistnallpdpyeservyvaeslissageglfskvav
    gpntvmsfyngvrithqevdsrdwalngntlsldeetvidvpepynhvskycaslghkan
    hsftpnciydmfvhprfgpikcirtlraveadeeltvaygydhsppgksgpeapewyqve
    lkafqatqqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o9sB (B:)
    gqykdnirhgvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemieg
    klatlmsteegrphfelmpgnsvyhfdkstsscistnallpdpyeservyvaeslissag
    eglfskvavgpntvmsfyngvrithqevdsrdwalngntlsldeetvidvpepynhvsky
    caslghkanhsftpnciydmfvhprfgpikcirtlraveadeeltvaygydhsppgksgp
    eapewyqvelkafqatqqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o9sB (B:)
    gvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklatlmste
    egrphfelmpgnsvyhfdkstsscistnallpdpyeservyvaeslissageglfskvav
    gpntvmsfyngvrithqevdsrdwalngntlsldeetvidvpepynhvskycaslghkan
    hsftpnciydmfvhprfgpikcirtlraveadeeltvaygydhsppgksgpeapewyqve
    lkafqatqqk