PDB entry 1o9s

View 1o9s on RCSB PDB site
Description: crystal structure of a ternary complex of the human histone methyltransferase set7/9
Class: transferase
Keywords: methylation, histone h3, methyltransferase, transferase
Deposited on 2002-12-18, released 2003-02-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.206
AEROSPACI score: -1.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histone-lysine n-methyltransferase, h3 lysine-4 specific
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1o9sa1, d1o9sa2
  • Chain 'B':
    Compound: histone-lysine n-methyltransferase, h3 lysine-4 specific
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1o9sb1, d1o9sb2
  • Chain 'K':
    Compound: gene fragment for histone h3
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16776 (0-9)
      • conflict (9)
  • Chain 'L':
    Compound: gene fragment for histone h3
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o9sA (A:)
    gqykdnirhgvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemieg
    klatlmsteegrphfelmpgnsvyhfdkstsscistnallpdpyeservyvaeslissag
    eglfskvavgpntvmsfyngvrithqevdsrdwalngntlsldeetvidvpepynhvsky
    caslghkanhsftpnciydmfvhprfgpikcirtlraveadeeltvaygydhsppgksgp
    eapewyqvelkafqatqqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o9sA (A:)
    gvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklatlmste
    egrphfelmpgnsvyhfdkstsscistnallpdpyeservyvaeslissageglfskvav
    gpntvmsfyngvrithqevdsrdwalngntlsldeetvidvpepynhvskycaslghkan
    hsftpnciydmfvhprfgpikcirtlraveadeeltvaygydhsppgksgpeapewyqve
    lkafqatqqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o9sB (B:)
    gqykdnirhgvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemieg
    klatlmsteegrphfelmpgnsvyhfdkstsscistnallpdpyeservyvaeslissag
    eglfskvavgpntvmsfyngvrithqevdsrdwalngntlsldeetvidvpepynhvsky
    caslghkanhsftpnciydmfvhprfgpikcirtlraveadeeltvaygydhsppgksgp
    eapewyqvelkafqatqqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o9sB (B:)
    gvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklatlmste
    egrphfelmpgnsvyhfdkstsscistnallpdpyeservyvaeslissageglfskvav
    gpntvmsfyngvrithqevdsrdwalngntlsldeetvidvpepynhvskycaslghkan
    hsftpnciydmfvhprfgpikcirtlraveadeeltvaygydhsppgksgpeapewyqve
    lkafqatqqk
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.