PDB entry 1o9r

View 1o9r on RCSB PDB site
Description: the x-ray crystal structure of agrobacterium tumefaciens dps, a member of the family that protect DNA without binding
Class: iron-binding protein
Keywords: iron-binding protein, DNA protection from oxidative damage, DNA-binding, iron- binding protein
Deposited on 2002-12-18, released 2003-05-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.18
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: agrobacterium tumefaciens dps
    Species: AGROBACTERIUM TUMEFACIENS [TaxId:358]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1o9ra_
  • Chain 'B':
    Compound: agrobacterium tumefaciens dps
    Species: AGROBACTERIUM TUMEFACIENS [TaxId:358]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1o9rb_
  • Chain 'C':
    Compound: agrobacterium tumefaciens dps
    Species: AGROBACTERIUM TUMEFACIENS [TaxId:358]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1o9rc_
  • Chain 'D':
    Compound: agrobacterium tumefaciens dps
    Species: AGROBACTERIUM TUMEFACIENS [TaxId:358]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1o9rd_
  • Chain 'E':
    Compound: agrobacterium tumefaciens dps
    Species: AGROBACTERIUM TUMEFACIENS [TaxId:358]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1o9re_
  • Chain 'F':
    Compound: agrobacterium tumefaciens dps
    Species: AGROBACTERIUM TUMEFACIENS [TaxId:358]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1o9rf_
  • Heterogens: FE, TRS, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1o9rA (A:)
    mkthktkndlpsnakstvigilneslasvidlalvtkqahwnlkgpqfiavhelldtfrt
    qldnhgdtiaervvqlggtalgslqavssttklkayptdiykihdhldalierygevanm
    irkaiddsdeagdpttadiftaasrdldkslwfleahvqeks
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1o9rB (B:)
    mkthktkndlpsnakstvigilneslasvidlalvtkqahwnlkgpqfiavhelldtfrt
    qldnhgdtiaervvqlggtalgslqavssttklkayptdiykihdhldalierygevanm
    irkaiddsdeagdpttadiftaasrdldkslwfleahvqeks
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1o9rC (C:)
    mkthktkndlpsnakstvigilneslasvidlalvtkqahwnlkgpqfiavhelldtfrt
    qldnhgdtiaervvqlggtalgslqavssttklkayptdiykihdhldalierygevanm
    irkaiddsdeagdpttadiftaasrdldkslwfleahvqeks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o9rC (C:)
    hktkndlpsnakstvigilneslasvidlalvtkqahwnlkgpqfiavhelldtfrtqld
    nhgdtiaervvqlggtalgslqavssttklkayptdiykihdhldalierygevanmirk
    aiddsdeagdpttadiftaasrdldkslwfleahvqeks
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1o9rD (D:)
    mkthktkndlpsnakstvigilneslasvidlalvtkqahwnlkgpqfiavhelldtfrt
    qldnhgdtiaervvqlggtalgslqavssttklkayptdiykihdhldalierygevanm
    irkaiddsdeagdpttadiftaasrdldkslwfleahvqeks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o9rD (D:)
    thktkndlpsnakstvigilneslasvidlalvtkqahwnlkgpqfiavhelldtfrtql
    dnhgdtiaervvqlggtalgslqavssttklkayptdiykihdhldalierygevanmir
    kaiddsdeagdpttadiftaasrdldkslwfleahvqeks
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1o9rE (E:)
    mkthktkndlpsnakstvigilneslasvidlalvtkqahwnlkgpqfiavhelldtfrt
    qldnhgdtiaervvqlggtalgslqavssttklkayptdiykihdhldalierygevanm
    irkaiddsdeagdpttadiftaasrdldkslwfleahvqeks
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1o9rF (F:)
    mkthktkndlpsnakstvigilneslasvidlalvtkqahwnlkgpqfiavhelldtfrt
    qldnhgdtiaervvqlggtalgslqavssttklkayptdiykihdhldalierygevanm
    irkaiddsdeagdpttadiftaasrdldkslwfleahvqeks