PDB entry 1o9k

View 1o9k on RCSB PDB site
Description: crystal structure of the retinoblastoma tumour suppressor protein bound to e2f peptide
Deposited on 2002-12-16, released 2003-03-06
The last revision prior to the SCOP 1.71 freeze date was dated 2003-03-06, with a file datestamp of 2003-03-06.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.23201
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1o9ka_
  • Chain 'B':
    Domains in SCOP 1.71: d1o9kb_
  • Chain 'C':
    Domains in SCOP 1.71: d1o9kc_
  • Chain 'D':
    Domains in SCOP 1.71: d1o9kd_
  • Chain 'E':
    Domains in SCOP 1.71: d1o9ke_
  • Chain 'F':
    Domains in SCOP 1.71: d1o9kf_
  • Chain 'G':
    Domains in SCOP 1.71: d1o9kg_
  • Chain 'H':
    Domains in SCOP 1.71: d1o9kh_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o9kA (A:)
    htpvrtvmntiqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfa
    kavgqgcveigsqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacal
    evvmatysrstsqnldsgtdlsfpwilnvlnlkafdfykviesfikaegnltremikhle
    rcehrimeslawlsdsplfdlikqskdregptdhlesa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o9kA (A:)
    mntiqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfakavgqgc
    veigsqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacalevvmaty
    srssgtdlsfpwilnvlnlkafdfykviesfikaegnltremikhlercehrimeslawl
    sdsplfdlikqskd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o9kB (B:)
    fqtqkplkstslslfykkvyrlaylrlntlcerllsehpelehiiwtlfqhtlqneyelm
    rdrhldqimmcsmygickvknidlkfkiivtaykdlphavqetfkrvlikeeeydsiivf
    ynsvfmqrlktnilqyastrpptlspiphipr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o9kB (B:)
    stslslfykkvyrlaylrlntlcerllsehpelehiiwtlfqhtlqneyelmrdrhldqi
    mmcsmygickvknidlkfkiivtaykdlphavqetfkrvlikeeeydsiivfynsvfmqr
    lktnilqyastrpptlspiphipr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1o9kC (C:)
    htpvrtvmntiqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfa
    kavgqgcveigsqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacal
    evvmatysrstsqnldsgtdlsfpwilnvlnlkafdfykviesfikaegnltremikhle
    rcehrimeslawlsdsplfdlikqskdregptdhlesa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o9kC (C:)
    mntiqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfakavgqgc
    veigsqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacalevvmaty
    srssgtdlsfpwilnvlnlkafdfykviesfikaegnltremikhlercehrimeslawl
    sdsplfdlikqskd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1o9kD (D:)
    fqtqkplkstslslfykkvyrlaylrlntlcerllsehpelehiiwtlfqhtlqneyelm
    rdrhldqimmcsmygickvknidlkfkiivtaykdlphavqetfkrvlikeeeydsiivf
    ynsvfmqrlktnilqyastrpptlspiphipr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o9kD (D:)
    stslslfykkvyrlaylrlntlcerllsehpelehiiwtlfqhtlqneyelmrdrhldqi
    mmcsmygickvknidlkfkiivtaykdlphavqetfkrvlikeeeydsiivfynsvfmqr
    lktnilqyastrpptlspiphipr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1o9kE (E:)
    htpvrtvmntiqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfa
    kavgqgcveigsqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacal
    evvmatysrstsqnldsgtdlsfpwilnvlnlkafdfykviesfikaegnltremikhle
    rcehrimeslawlsdsplfdlikqskdregptdhlesa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o9kE (E:)
    mntiqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfakavgqgc
    veigsqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacalevvmaty
    srssgtdlsfpwilnvlnlkafdfykviesfikaegnltremikhlercehrimeslawl
    sdsplfdlikqskd
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1o9kF (F:)
    fqtqkplkstslslfykkvyrlaylrlntlcerllsehpelehiiwtlfqhtlqneyelm
    rdrhldqimmcsmygickvknidlkfkiivtaykdlphavqetfkrvlikeeeydsiivf
    ynsvfmqrlktnilqyastrpptlspiphipr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o9kF (F:)
    stslslfykkvyrlaylrlntlcerllsehpelehiiwtlfqhtlqneyelmrdrhldqi
    mmcsmygickvknidlkfkiivtaykdlphavqetfkrvlikeeeydsiivfynsvfmqr
    lktnilqyastrpptlspiphipr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1o9kG (G:)
    htpvrtvmntiqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfa
    kavgqgcveigsqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacal
    evvmatysrstsqnldsgtdlsfpwilnvlnlkafdfykviesfikaegnltremikhle
    rcehrimeslawlsdsplfdlikqskdregptdhlesa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o9kG (G:)
    mntiqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfakavgqgc
    veigsqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacalevvmaty
    srssgtdlsfpwilnvlnlkafdfykviesfikaegnltremikhlercehrimeslawl
    sdsplfdlikqskd
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1o9kH (H:)
    fqtqkplkstslslfykkvyrlaylrlntlcerllsehpelehiiwtlfqhtlqneyelm
    rdrhldqimmcsmygickvknidlkfkiivtaykdlphavqetfkrvlikeeeydsiivf
    ynsvfmqrlktnilqyastrpptlspiphipr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o9kH (H:)
    stslslfykkvyrlaylrlntlcerllsehpelehiiwtlfqhtlqneyelmrdrhldqi
    mmcsmygickvknidlkfkiivtaykdlphavqetfkrvlikeeeydsiivfynsvfmqr
    lktnilqyastrpptlspiphipr