PDB entry 1o9b

View 1o9b on RCSB PDB site
Description: quinate/shikimate dehydrogenase ydib complexed with nadh
Class: oxidoreductase
Keywords: oxidoreductase, quinate, shikimate, nad, montreal-kingston bacterial structural genomics initiative, bsgi, structural genomics
Deposited on 2002-12-12, released 2003-02-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.226
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical shikimate 5-dehydrogenase-like protein ydib
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1o9ba1, d1o9ba2
  • Chain 'B':
    Compound: hypothetical shikimate 5-dehydrogenase-like protein ydib
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1o9bb1, d1o9bb2
  • Heterogens: NAI, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o9bA (A:)
    mdvtakyeliglmaypirhslspemqnkalekaglpftymafevdndsfpgaieglkalk
    mrgtgvsmpnkqlaceyvdeltpaaklvgaintivnddgylrgyntdgtghiraikesgf
    dikgktmvllgaggastaigaqgaieglkeiklfnrrdeffdkalafaqrvnentdcvvt
    vtdladqqafaealasadiltngtkvgmkpleneslvndisllhpgllvtecvynphmtk
    llqqaqqagcktidgygmllwqgaeqftlwtgkdfpleyvkqvmgfga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o9bA (A:)
    yeliglmaypirhslspemqnkalekaglpftymafevdndsfpgaieglkalkmrgtgv
    smpnkqlaceyvdeltpaaklvgaintivnddgylrgyntdgtghiraikesgfdikgkt
    mvllgaggastaigaqgaieglkeiklfnrrdeffdkalafaqrvnentdcvvtvtdlad
    qqafaealasadiltngtkvgmkpleneslvndisllhpgllvtecvynphmtkllqqaq
    qagcktidgygmllwqgaeqftlwtgkdfpleyvkqvmgfg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o9bB (B:)
    mdvtakyeliglmaypirhslspemqnkalekaglpftymafevdndsfpgaieglkalk
    mrgtgvsmpnkqlaceyvdeltpaaklvgaintivnddgylrgyntdgtghiraikesgf
    dikgktmvllgaggastaigaqgaieglkeiklfnrrdeffdkalafaqrvnentdcvvt
    vtdladqqafaealasadiltngtkvgmkpleneslvndisllhpgllvtecvynphmtk
    llqqaqqagcktidgygmllwqgaeqftlwtgkdfpleyvkqvmgfga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o9bB (B:)
    yeliglmaypirhslspemqnkalekaglpftymafevdndsfpgaieglkalkmrgtgv
    smpnkqlaceyvdeltpaaklvgaintivnddgylrgyntdgtghiraikesgfdikgkt
    mvllgaggastaigaqgaieglkeiklfnrrdeffdkalafaqrvnentdcvvtvtdlad
    qqafaealasadiltngtkvgmkpleneslvndisllhpgllvtecvynphmtkllqqaq
    qagcktidgygmllwqgaeqftlwtgkdfpleyvkqvmgfg