PDB entry 1o9b

View 1o9b on RCSB PDB site
Description: quinate/shikimate dehydrogenase ydib complexed with nadh
Deposited on 2002-12-12, released 2003-02-01
The last revision prior to the SCOP 1.65 freeze date was dated 2003-05-22, with a file datestamp of 2003-05-22.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.226
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o9bA (A:)
    mdvtakyeliglmaypirhslspemqnkalekaglpftymafevdndsfpgaieglkalk
    mrgtgvsmpnkqlaceyvdeltpaaklvgaintivnddgylrgyntdgtghiraikesgf
    dikgktmvllgaggastaigaqgaieglkeiklfnrrdeffdkalafaqrvnentdcvvt
    vtdladqqafaealasadiltngtkvgmkpleneslvndisllhpgllvtecvynphmtk
    llqqaqqagcktidgygmllwqgaeqftlwtgkdfpleyvkqvmgfga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o9bA (A:)
    yeliglmaypirhslspemqnkalekaglpftymafevdndsfpgaieglkalkmrgtgv
    smpnkqlaceyvdeltpaaklvgaintivnddgylrgyntdgtghiraikesgfdikgkt
    mvllgaggastaigaqgaieglkeiklfnrrdeffdkalafaqrvnentdcvvtvtdlad
    qqafaealasadiltngtkvgmkpleneslvndisllhpgllvtecvynphmtkllqqaq
    qagcktidgygmllwqgaeqftlwtgkdfpleyvkqvmgfg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o9bB (B:)
    mdvtakyeliglmaypirhslspemqnkalekaglpftymafevdndsfpgaieglkalk
    mrgtgvsmpnkqlaceyvdeltpaaklvgaintivnddgylrgyntdgtghiraikesgf
    dikgktmvllgaggastaigaqgaieglkeiklfnrrdeffdkalafaqrvnentdcvvt
    vtdladqqafaealasadiltngtkvgmkpleneslvndisllhpgllvtecvynphmtk
    llqqaqqagcktidgygmllwqgaeqftlwtgkdfpleyvkqvmgfga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o9bB (B:)
    yeliglmaypirhslspemqnkalekaglpftymafevdndsfpgaieglkalkmrgtgv
    smpnkqlaceyvdeltpaaklvgaintivnddgylrgyntdgtghiraikesgfdikgkt
    mvllgaggastaigaqgaieglkeiklfnrrdeffdkalafaqrvnentdcvvtvtdlad
    qqafaealasadiltngtkvgmkpleneslvndisllhpgllvtecvynphmtkllqqaq
    qagcktidgygmllwqgaeqftlwtgkdfpleyvkqvmgfg