PDB entry 1o9a

View 1o9a on RCSB PDB site
Description: solution structure of the complex of 1f12f1 from fibronectin with b3 from fnbb from s. dysgalactiae
Class: cell adhesion
Keywords: cell adhesion/complex, host-pathogen protein complex, cell adhesion, fibronectin
Deposited on 2002-12-11, released 2003-05-08
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fibronectin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1o9aa1, d1o9aa2
  • Chain 'B':
    Compound: fibronectin binding protein
    Species: STREPTOCOCCUS DYSGALACTIAE, synthetic [TaxId:1334]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1o9aA (A:)
    skpgcydngkhyqinqqwertylgnalvctcyggsrgfnceskpeaeetcfdkytgntyr
    vgdtyerpkdsmiwdctcigagrgrisctianr
    

  • Chain 'B':
    No sequence available.