PDB entry 1o9a

View 1o9a on RCSB PDB site
Description: solution structure of the complex of 1f12f1 from fibronectin with b3 from fnbb from s. dysgalactiae
Deposited on 2002-12-11, released 2003-05-08
The last revision prior to the SCOP 1.69 freeze date was dated 2003-05-08, with a file datestamp of 2003-05-08.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1o9aA (A:)
    skpgcydngkhyqinqqwertylgnalvctcyggsrgfnceskpeaeetcfdkytgntyr
    vgdtyerpkdsmiwdctcigagrgrisctianr