PDB entry 1o98

View 1o98 on RCSB PDB site
Description: 1.4a crystal structure of phosphoglycerate mutase from bacillus stearothermophilus complexed with 2-phosphoglycerate
Class: isomerase
Keywords: isomerase, alpha/beta-type structure
Deposited on 2002-12-11, released 2003-05-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.19
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X519
      • conflict see remark 9 (350)
    Domains in SCOPe 2.08: d1o98a1, d1o98a2
  • Heterogens: MN, 2PG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o98A (A:)
    mskkpvaliildgfalrdetygnavaqankpnfdrywneyphttlkacgeavglpegqmg
    nsevghlnigagrivyqsltriniairegefdrnetflaamnhvkqhgtslhlfgllsdg
    gvhshihhlyallrlaakegvkrvyihgfldgrdvgpqtapqyikelqekikeygvgeia
    tlsgryysmdrdkrwdrvekayramvygegptyrdpleciedsykhgiydefvlpsvivr
    edgrpvatiqdndaiifynfrpdraiqisntftnedfrefdrgpkhpkhlffvclthfse
    tvagyvafkptnldntigevlsqhglrqlriaetekyphvtffmsggreeefpgedrili
    nspkvptydlkpemsayevtdallkeieadkydaiilnyanpdmvghsgkleptikavea
    vdeclgkvvdailakggiaiitadhgnadevltpdgkpqtahttnpvpvivtkkgiklrd
    ggilgdlaptmldllglpqpkemtgkslivk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o98A (A:)
    skkpvaliildgfalrdetygnavaqankpnfdrywneyphttlkacgeavglpegqmgn
    sevghlnigagrivyqsltriniairegefdrnetflaamnhvkqhgtslhlfgllsdgg
    vhshihhlyallrlaakegvkrvyihgfldgrdvgpqtapqyikelqekikeygvgeiat
    lsgryysmdrdkrwdrvekayramvygegptyrdpleciedsykhgiydefvlpsvivre
    dgrpvatiqdndaiifynfrpdraiqisntftnedfrefdrgpkhpkhlffvclthfset
    vagyvafkptnldntigevlsqhglrqlriaetekyphvtffmsggreeefpgedrilin
    spkvptydlkpemsayevtdallkeieadkydaiilnyanpdmvghsgkleptikaveav
    declgkvvdailakggiaiitadhgnadevltpdgkpqtahttnpvpvivtkkgiklrdg
    gilgdlaptmldllglpqpkemtgksliv