PDB entry 1o95

View 1o95 on RCSB PDB site
Description: Ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein
Class: electron transport
Keywords: electron transport-complex, protein complex, electron transfer, dehydrogenase, electron transport, flavoprotein, oxido-reductase, iron-sulfur, fmn
Deposited on 2002-12-11, released 2003-02-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-09-18, with a file datestamp of 2013-09-13.
Experiment type: XRAY
Resolution: 3.7 Å
R-factor: 0.257
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trimethylamine dehydrogenase
    Species: Methylophilus methylotrophus [TaxId:17]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1o95a1, d1o95a2, d1o95a3
  • Chain 'B':
    Compound: trimethylamine dehydrogenase
    Species: Methylophilus methylotrophus [TaxId:17]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1o95b1, d1o95b2, d1o95b3
  • Chain 'C':
    Compound: Electron transfer flavoprotein beta-subunit
    Species: Methylophilus methylotrophus [TaxId:17]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1o95c_
  • Chain 'D':
    Compound: electron transfer flavoprotein alpha-subunit
    Species: Methylophilus methylotrophus [TaxId:17]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1o95d_
  • Chain 'E':
    Compound: Electron transfer flavoprotein beta-subunit
    Species: Methylophilus methylotrophus [TaxId:17]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1o95e_
  • Chain 'F':
    Compound: electron transfer flavoprotein alpha-subunit
    Species: Methylophilus methylotrophus [TaxId:17]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1o95f_
  • Heterogens: FMN, ADP, SF4, AMP

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1o95A (A:)
    ardpkhdilfepiqigpktlrnrfyqvphcigagsdkpgfqsahrsvkaeggwaalntey
    csinpesddthrlsariwdegdvrnlkamtdevhkygalagvelwyggahapnmesratp
    rgpsqyasefetlsyckemdlsdiaqvqqfyvdaakrsrdagfdivyvygahsylplqfl
    npyynkrtdkyggslenrarfwletlekvkhavgsdcaiatrfgvdtvygpgqieaevdg
    qkfvemadslvdmwditigdiaewgedagpsrfyqqghtipwvklvkqvskkpvlgvgry
    tdpekmieivtkgyadiigcarpsiadpflpqkveqgryddirvcigcnvcisrweiggp
    pmictqnatageeyrrgwhpekfrqtknkdsvlivgagpsgseaarvlmesgytvhltdt
    aekigghlnqvaalpglgewsyhrdyretqitkllkknkesqlalgqkpmtaddvlqyga
    dkviiatgarwntdgtnclthdpipgadaslpdqltpeqvmdgkkkigkrvvilnadtyf
    mapslaeklataghevtivsgvhlanymhftleypnmmrrlhelhveelgdhfcsriepg
    rmeiyniwgdgskrtyrgpgvsprdantshrwiefdslvlvtgrhsectlwnelkarese
    waendikgiyligdaeaprliadatftghrvareieeanpqiaipykretiawgtphmpg
    gnfkieykv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1o95B (B:)
    ardpkhdilfepiqigpktlrnrfyqvphcigagsdkpgfqsahrsvkaeggwaalntey
    csinpesddthrlsariwdegdvrnlkamtdevhkygalagvelwyggahapnmesratp
    rgpsqyasefetlsyckemdlsdiaqvqqfyvdaakrsrdagfdivyvygahsylplqfl
    npyynkrtdkyggslenrarfwletlekvkhavgsdcaiatrfgvdtvygpgqieaevdg
    qkfvemadslvdmwditigdiaewgedagpsrfyqqghtipwvklvkqvskkpvlgvgry
    tdpekmieivtkgyadiigcarpsiadpflpqkveqgryddirvcigcnvcisrweiggp
    pmictqnatageeyrrgwhpekfrqtknkdsvlivgagpsgseaarvlmesgytvhltdt
    aekigghlnqvaalpglgewsyhrdyretqitkllkknkesqlalgqkpmtaddvlqyga
    dkviiatgarwntdgtnclthdpipgadaslpdqltpeqvmdgkkkigkrvvilnadtyf
    mapslaeklataghevtivsgvhlanymhftleypnmmrrlhelhveelgdhfcsriepg
    rmeiyniwgdgskrtyrgpgvsprdantshrwiefdslvlvtgrhsectlwnelkarese
    waendikgiyligdaeaprliadatftghrvareieeanpqiaipykretiawgtphmpg
    gnfkieykv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1o95C (C:)
    mkilvavkqtaaleedfeiredgmdvdedfmmydlnewddfsleeamkikessdtdvevv
    vvsvgpdrvdeslrkclakgadravrvwddaaegsdaivvgriltevikkeapdmvfagv
    qssdqayastgisvasylnwphaavvadlqykpgdnkavirreleggmlqeveincpavl
    tiqlginkpryaslrgikqaatkpieevsladiglsandvgaaqsmsrvrrmyipekgra
    tmiegtiseqaakiiqiinefkga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o95C (C:)
    mkilvavkqtaaleedfeirdgmdvdedfmmydlnewddfsleeamkikessddvevvvv
    svgpdrvdeslrkclakgadravrvwddaaegsdaivvgriltevikkeapdmvfagvqs
    sdqayastgisvasylnwphaavvadlqykpgdnkavirreleggmlqeveincpavlti
    qlginkpryaslrgikqaatkpieevsladiglsandvgaaqsmsrvrrmyip
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1o95D (D:)
    skilviaehrrndlrpvsleligaanglkksgedkvvvavigsqadafvpalsvngvdel
    vvvkgssidfdpdvfeasvsaliaahnpsvvllphsvdslgyasslasktgygfatdvyi
    veyqgdelvatrggynqkvnvevdfpgkstvvltirpsvfkplegagspvvsnvdapsvq
    srsqnkdyvevgggndidittvdfimsigrgigeetnveqfreladeagatlccsrpiad
    agwlpksrqvgqsgkvvgscklyvamgisgsiqhmagmkhvptiiavntdpgasiftiak
    ygivadifdieeelkaqlaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o95D (D:)
    skilviaehrrndlrpvsleligaanglkksgedkvvvavigsqadafvpalsvngvdel
    vvvkgssidfdpdvfeasvsaliaahnpsvvllphsvdslgyasslasktgygfatdvyi
    veyqgdelvatrggynqkvnvevdfpgkstvvltirpsvfkplegagspvvsnvdapsvq
    srsqnkdyv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1o95E (E:)
    mkilvavkqtaaleedfeiredgmdvdedfmmydlnewddfsleeamkikessdtdvevv
    vvsvgpdrvdeslrkclakgadravrvwddaaegsdaivvgriltevikkeapdmvfagv
    qssdqayastgisvasylnwphaavvadlqykpgdnkavirreleggmlqeveincpavl
    tiqlginkpryaslrgikqaatkpieevsladiglsandvgaaqsmsrvrrmyipekgra
    tmiegtiseqaakiiqiinefkga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o95E (E:)
    mkilvavkqtaaleedfeiredgmdvdedfmmydlnewddfsleeamkikessdtdvevv
    vvsvgpdrvdeslrkclakgadravrvwddaaegsdaivvgriltevikkeapdmvfagv
    qssdqayastgisvasylnwphaavvadlqykpgdnkavirreleggmlqeveincpavl
    tiqlginkpryaslrgikqaatkpieevsladiglsandvgaaqsmsrvrrmyipe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1o95F (F:)
    skilviaehrrndlrpvsleligaanglkksgedkvvvavigsqadafvpalsvngvdel
    vvvkgssidfdpdvfeasvsaliaahnpsvvllphsvdslgyasslasktgygfatdvyi
    veyqgdelvatrggynqkvnvevdfpgkstvvltirpsvfkplegagspvvsnvdapsvq
    srsqnkdyvevgggndidittvdfimsigrgigeetnveqfreladeagatlccsrpiad
    agwlpksrqvgqsgkvvgscklyvamgisgsiqhmagmkhvptiiavntdpgasiftiak
    ygivadifdieeelkaqlaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o95F (F:)
    skilviaehrrndlrpvsleligaanglkksgedkvvvavigsqadafvpalsvngvdel
    vvvkgssidfdpdvfeasvsaliaahnpsvvllphsvdslgyasslasktgygfatdvyi
    veyqgdelvatrggynqkvnvevdfpgkstvvltirpsvfkplegagspvvsnvdapsvq
    srsqnkdyv