PDB entry 1o91

View 1o91 on RCSB PDB site
Description: Crystal Structure of a Collagen VIII NC1 Domain Trimer
Class: structural protein
Keywords: collagen, c1q_like_domain, extracellular matrix, adhesion, connective tissue, structural protein
Deposited on 2002-12-10, released 2003-11-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: collagen alpha 1(viii) chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1O91
    • Uniprot Q00780 (Start-177)
    Domains in SCOPe 2.07: d1o91a_
  • Chain 'B':
    Compound: collagen alpha 1(viii) chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1O91
    • Uniprot Q00780 (Start-177)
    Domains in SCOPe 2.07: d1o91b_
  • Chain 'C':
    Compound: collagen alpha 1(viii) chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1O91
    • Uniprot Q00780 (Start-177)
    Domains in SCOPe 2.07: d1o91c_
  • Heterogens: CPS, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o91A (A:)
    hhhhhhavmptpspqgeylpdmglgidgvktphayagkkgkhggpayempaftaeltvpf
    ppvgapvkfdkllyngrqnynpqtgiftcevpgvyyfayhvhckggnvwvalfknnepmm
    ytydeykkgfldqasgsavlllrpgdqvflqmpseqaaglyagqyvhssfsgyllypm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o91A (A:)
    empaftaeltvpfppvgapvkfdkllyngrqnynpqtgiftcevpgvyyfayhvhckggn
    vwvalfknnepmmytydeykkgfldqasgsavlllrpgdqvflqmpseqaaglyagqyvh
    ssfsgyllypm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o91B (B:)
    hhhhhhavmptpspqgeylpdmglgidgvktphayagkkgkhggpayempaftaeltvpf
    ppvgapvkfdkllyngrqnynpqtgiftcevpgvyyfayhvhckggnvwvalfknnepmm
    ytydeykkgfldqasgsavlllrpgdqvflqmpseqaaglyagqyvhssfsgyllypm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o91B (B:)
    empaftaeltvpfppvgapvkfdkllyngrqnynpqtgiftcevpgvyyfayhvhckggn
    vwvalfknnepmmytydeykkgfldqasgsavlllrpgdqvflqmpseqaaglyagqyvh
    ssfsgyllypm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1o91C (C:)
    hhhhhhavmptpspqgeylpdmglgidgvktphayagkkgkhggpayempaftaeltvpf
    ppvgapvkfdkllyngrqnynpqtgiftcevpgvyyfayhvhckggnvwvalfknnepmm
    ytydeykkgfldqasgsavlllrpgdqvflqmpseqaaglyagqyvhssfsgyllypm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o91C (C:)
    empaftaeltvpfppvgapvkfdkllyngrqnynpqtgiftcevpgvyyfayhvhckggn
    vwvalfknnepmmytydeykkgfldqasgsavlllrpgdqvflqmpseqaaglyagqyvh
    ssfsgyllypm