PDB entry 1o8v

View 1o8v on RCSB PDB site
Description: the crystal structure of echinococcus granulosus fatty-acid-binding protein 1
Class: lipid binding protein
Keywords: lipid binding protein, fatty-acid-binding protein, echinococcus granulosus, hydatid disease, fatty-acid transport
Deposited on 2002-12-04, released 2003-06-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.174
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fatty acid binding protein homolog
    Species: ECHINOCOCCUS GRANULOSUS [TaxId:6210]
    Database cross-references and differences (RAF-indexed):
    • PDB 1O8V
    • Uniprot Q02970 (0-132)
    Domains in SCOPe 2.05: d1o8va_
  • Heterogens: PLM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1o8vA (A:)
meaflgtwkmeksegfdkimerlgvdfvtrkmgnlvkpnlivtdlgggkykmrsestfkt
tecsfklgekfkevtpdsrevaslitvengvmkheqddktkvtyiervvegnelkatvkv
devvcvrtyskva