PDB entry 1o8s

View 1o8s on RCSB PDB site
Description: structure of cscbm6-3 from clostridium stercorarium in complex with cellobiose
Class: hydrolase
Keywords: hydrolase, carbohydrate-binding module, xylan, cellulose, beta- sandwich, glycosidase, xylan degradation
Deposited on 2002-11-28, released 2003-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.124
AEROSPACI score: 0.9 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative endo-xylanase
    Species: CLOSTRIDIUM STERCORARIUM [TaxId:1510]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1o8sa_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o8sA (A:)
    mgsshhhhhhssglvprgshmastpanvnsgptspvggtrsafsniqaedydssygpnlq
    ifslpgggsaigyiengysttyknidfgdgatsvtarvatqnattiqvrlgspsgtllgt
    iyvgstgsfdtyrdvsatisntagvkdivlvfsgpvnvdwfvfsksgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o8sA (A:)
    vggtrsafsniqaedydssygpnlqifslpgggsaigyiengysttyknidfgdgatsvt
    arvatqnattiqvrlgspsgtllgtiyvgstgsfdtyrdvsatisntagvkdivlvfsgp
    vnvdwfvfsksg