PDB entry 1o8c

View 1o8c on RCSB PDB site
Description: crystal structure of e. coli k-12 yhdh with bound nadph
Deposited on 2002-11-26, released 2004-05-21
The last revision prior to the SCOP 1.71 freeze date was dated 2004-09-30, with a file datestamp of 2004-09-30.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.17275
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o8cA (A:)
    msyyhhhhhhlestslykkaglqallleqqdgktlasvqtldesrlpegdvtvdvhwssl
    nykdalaitgkgkiirnfpmipgidfagtvrtsedprfhagqevlltgwgvgenhwggla
    eqarvkgdwlvampqgldarkamiigtagftamlcvmaledagvrpqdgeivvtgasggv
    gstavallhklgyqvvavsgrestheylkslgasrvlprdefaesrplekqvwagaidtv
    gdkvlakvlaqmnyggcvaacglaggftlpttvmpfilrnvrlqgvdsvmtpperraqaw
    qrlvadlpesfytqaakeislseapnfaeaiinnqiqgrtlvkvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o8cA (A:)
    lqallleqqdgktlasvqtldesrlpegdvtvdvhwsslnykdalaitgkgkiirnfpmi
    pgidfagtvrtsedprfhagqevlltgwgvgenhwgglaeqarvkgdwlvampqgldark
    amiigtagftamlcvmaledagvrpqdgeivvtgasggvgstavallhklgyqvvavsgr
    estheylkslgasrvlprdefaesrplekqvwagaidtvgdkvlakvlaqmnyggcvaac
    glaggftlpttvmpfilrnvrlqgvdsvmtpperraqawqrlvadlpesfytqaakeisl
    seapnfaeaiinnqiqgrtlvkvn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o8cB (B:)
    msyyhhhhhhlestslykkaglqallleqqdgktlasvqtldesrlpegdvtvdvhwssl
    nykdalaitgkgkiirnfpmipgidfagtvrtsedprfhagqevlltgwgvgenhwggla
    eqarvkgdwlvampqgldarkamiigtagftamlcvmaledagvrpqdgeivvtgasggv
    gstavallhklgyqvvavsgrestheylkslgasrvlprdefaesrplekqvwagaidtv
    gdkvlakvlaqmnyggcvaacglaggftlpttvmpfilrnvrlqgvdsvmtpperraqaw
    qrlvadlpesfytqaakeislseapnfaeaiinnqiqgrtlvkvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o8cB (B:)
    lqallleqqdgktlasvqtldesrlpegdvtvdvhwsslnykdalaitgkgkiirnfpmi
    pgidfagtvrtsedprfhagqevlltgwgvgenhwgglaeqarvkgdwlvampqgldark
    amiigtagftamlcvmaledagvrpqdgeivvtgasggvgstavallhklgyqvvavsgr
    estheylkslgasrvlprdefaesrplekqvwagaidtvgdkvlakvlaqmnyggcvaac
    glaggftlpttvmpfilrnvrlqgvdsvmtpperraqawqrlvadlpesfytqaakeisl
    seapnfaeaiinnqiqgrtlvkvn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1o8cC (C:)
    msyyhhhhhhlestslykkaglqallleqqdgktlasvqtldesrlpegdvtvdvhwssl
    nykdalaitgkgkiirnfpmipgidfagtvrtsedprfhagqevlltgwgvgenhwggla
    eqarvkgdwlvampqgldarkamiigtagftamlcvmaledagvrpqdgeivvtgasggv
    gstavallhklgyqvvavsgrestheylkslgasrvlprdefaesrplekqvwagaidtv
    gdkvlakvlaqmnyggcvaacglaggftlpttvmpfilrnvrlqgvdsvmtpperraqaw
    qrlvadlpesfytqaakeislseapnfaeaiinnqiqgrtlvkvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o8cC (C:)
    qallleqqdgktlasvqtldesrlpegdvtvdvhwsslnykdalaitgkgkiirnfpmip
    gidfagtvrtsedprfhagqevlltgwgvgenhwgglaeqarvkgdwlvampqgldarka
    miigtagftamlcvmaledagvrpqdgeivvtgasggvgstavallhklgyqvvavsgre
    stheylkslgasrvlprdefaesrplekqvwagaidtvgdkvlakvlaqmnyggcvaacg
    laggftlpttvmpfilrnvrlqgvdsvmtpperraqawqrlvadlpesfytqaakeisls
    eapnfaeaiinnqiqgrtlvkvn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1o8cD (D:)
    msyyhhhhhhlestslykkaglqallleqqdgktlasvqtldesrlpegdvtvdvhwssl
    nykdalaitgkgkiirnfpmipgidfagtvrtsedprfhagqevlltgwgvgenhwggla
    eqarvkgdwlvampqgldarkamiigtagftamlcvmaledagvrpqdgeivvtgasggv
    gstavallhklgyqvvavsgrestheylkslgasrvlprdefaesrplekqvwagaidtv
    gdkvlakvlaqmnyggcvaacglaggftlpttvmpfilrnvrlqgvdsvmtpperraqaw
    qrlvadlpesfytqaakeislseapnfaeaiinnqiqgrtlvkvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o8cD (D:)
    lqallleqqdgktlasvqtldesrlpegdvtvdvhwsslnykdalaitgkgkiirnfpmi
    pgidfagtvrtsedprfhagqevlltgwgvgenhwgglaeqarvkgdwlvampqgldark
    amiigtagftamlcvmaledagvrpqdgeivvtgasggvgstavallhklgyqvvavsgr
    estheylkslgasrvlprdefaesrplekqvwagaidtvgdkvlakvlaqmnyggcvaac
    glaggftlpttvmpfilrnvrlqgvdsvmtpperraqawqrlvadlpesfytqaakeisl
    seapnfaeaiinnqiqgrtlvkvn