PDB entry 1o8b

View 1o8b on RCSB PDB site
Description: structure of escherichia coli ribose-5-phosphate isomerase, rpia, complexed with arabinose-5-phosphate.
Deposited on 2002-11-26, released 2003-01-24
The last revision prior to the SCOP 1.63 freeze date was dated 2003-01-24, with a file datestamp of 2003-01-24.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.22435
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o8bA (A:)
    ivgvgtgstaahfidalgtmkgqiegavsssdasteklkslgihvfdlnevdslgiyvdg
    adeinghmqmikgggaaltrekiiasvaekficiadaskqvdilgkfplpvevipmarsa
    varqlvklggrpeyrqgvvtdngnvildvhgmeildpiamenainaipgvvtvglfanrg
    advaligtpdgvktiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o8bA (A:)
    ivgvgtgstegavsssdafdlnevdslgiyvdgadeinghmqmikgggaltrekiiasva
    ekficiadaskqvdilgkfplpvevipmarsavarqlvklggrpeyrqgvvtdngnvild
    vhgmeildpiamenainaipgvvtvglfanrgadvaligtpdgvktiv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o8bB (B:)
    tqdelkkavgwaalqyvqpgtivgvgtgstaahfidalgtmkgqiegavsssdasteklk
    slgihvfdlnevdslgiyvdgadeinghmqmikgggaaltrekiiasvaekficiadask
    qvdilgkfplpvevipmarsavarqlvklggrpeyrqgvvtdngnvildvhgmeildpia
    menainaipgvvtvglfanrgadvaligtpdgvktiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o8bB (B:)
    tqdelkkavgwaalqytivgvgtgstaahfidalgtmkgqiegavsssdasteklkslgi
    hvfdlnevdslgiyvdgadeinghmqmikgggaltrekiiasvaekficiadaskqvdil
    gkfplpvevipmarsavarqlvklggrpeyrqgvvtdngnvildvhgmeildpiamenai
    naipgvvtvglfanrgadvaligtpdgvktiv