PDB entry 1o8b

View 1o8b on RCSB PDB site
Description: Structure of Escherichia coli ribose-5-phosphate isomerase, RpiA, complexed with arabinose-5-phosphate.
Class: isomerase
Keywords: isomerase, ribose phosphate isomerase, rpia, psi, protein structure initiative, mcsg, midwest center for structural genomics
Deposited on 2002-11-26, released 2003-01-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: N/A
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribose 5-phosphate isomerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1o8ba1, d1o8ba2
  • Chain 'B':
    Compound: Ribose 5-phosphate isomerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1o8bb1, d1o8bb2
  • Heterogens: ABF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o8bA (A:)
    mtqdelkkavgwaalqyvqpgtivgvgtgstaahfidalgtmkgqiegavsssdastekl
    kslgihvfdlnevdslgiyvdgadeinghmqmikgggaaltrekiiasvaekficiadas
    kqvdilgkfplpvevipmarsavarqlvklggrpeyrqgvvtdngnvildvhgmeildpi
    amenainaipgvvtvglfanrgadvaligtpdgvktivk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o8bA (A:)
    ivgvgtgstegavsssdafdlnevdslgiyvdgadeinghmqmikgggaltrekiiasva
    ekficiadaskqvdilgkfplpvevipmarsavarqlvklggrpeyrqgvvtdngnvild
    vhgmeildpiamenainaipgvvtvglfanrgadvaligtpdgvktiv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o8bB (B:)
    mtqdelkkavgwaalqyvqpgtivgvgtgstaahfidalgtmkgqiegavsssdastekl
    kslgihvfdlnevdslgiyvdgadeinghmqmikgggaaltrekiiasvaekficiadas
    kqvdilgkfplpvevipmarsavarqlvklggrpeyrqgvvtdngnvildvhgmeildpi
    amenainaipgvvtvglfanrgadvaligtpdgvktivk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o8bB (B:)
    tqdelkkavgwaalqytivgvgtgstaahfidalgtmkgqiegavsssdasteklkslgi
    hvfdlnevdslgiyvdgadeinghmqmikgggaltrekiiasvaekficiadaskqvdil
    gkfplpvevipmarsavarqlvklggrpeyrqgvvtdngnvildvhgmeildpiamenai
    naipgvvtvglfanrgadvaligtpdgvktiv