PDB entry 1o89

View 1o89 on RCSB PDB site
Description: crystal structure of e. coli k-12 yhdh
Deposited on 2002-11-26, released 2004-02-26
The last revision prior to the SCOP 1.71 freeze date was dated 2004-02-26, with a file datestamp of 2004-02-26.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.20087
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o89A (A:)
    msyyhhhhhhlestslykkaglqallleqqdgktlasvqtldesrlpegdvtvdvhwssl
    nykdalaitgkgkiirnfpmipgidfagtvrtsedprfhagqevlltgwgvgenhwggla
    eqarvkgdwlvampqgldarkamiigtagftamlcvmaledagvrpqdgeivvtgasggv
    gstavallhklgyqvvavsgrestheylkslgasrvlprdefaesrplekqvwagaidtv
    gdkvlakvlaqmnyggcvaacglaggftlpttvmpfilrnvrlqgvdsvmtpperraqaw
    qrlvadlpesfytqaakeislseapnfaeaiinnqiqgrtlvkvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o89A (A:)
    lqallleqqtlasvqtldesrlpegdvtvdvhwsslnykdalaitgkgkiirnfpmipgi
    dfagtvrtsedprfhagqevlltgwgvgenhwgglaeqarvkgdwlvampqgldarkami
    igtagftamlcvmaledagvrpqdgeivvtgasggvgstavallhklgyqvvavsgrest
    heylkslgasrvlprdefaesrplekqvwagaidtvgdkvlakvlaqmnyggcvaacgla
    ggftlpttvmpfilrnvrlqgvdsvmtpperraqawqrlvadlpesfytqaakeislsea
    pnfaeaiinnqiqgrtlvkv