PDB entry 1o86

View 1o86 on RCSB PDB site
Description: crystal structure of human angiotensin converting enzyme in complex with lisinopril.
Class: metalloprotease
Keywords: ace, peptidyl dipeptidase, type-I membrane-anchored protein.
Deposited on 2002-11-25, released 2003-02-07
The last revision prior to the SCOP 1.73 freeze date was dated 2006-03-06, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.18
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: angiotensin converting enzyme
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1o86a_
  • Heterogens: ZN, CL, GLY, LPR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o86A (A:)
    lvtdeaeaskfveeydrtsqvvwneyaeanwnyntnittetskillqknmqianhtlkyg
    tqarkfdvnqlqnttikriikkvqdleraalpaqeleeynkilldmettysvatvchpng
    sclqlepdltnvmatsrkyedllwawegwrdkagrailqfypkyvelinqaarlngyvda
    gdswrsmyetpsleqdlerlfqelqplylnlhayvrralhrhygaqhinlegpipahllg
    nmwaqtwsniydlvvpfpsapsmdtteamlkqgwtprrmfkeaddfftslgllpvppefw
    nksmlekptdgrevvchasawdfyngkdfrikqcttvnledlvvahhemghiqyfmqykd
    lpvalreganpgfheaigdvlalsvstpkhlhslnllsseggsdehdinflmkmaldkia
    fipfsylvdqwrwrvfdgsitkenynqewwslrlkyqglcppvprtqgdfdpgakfhips
    svpyiryfvsfiiqfqfhealcqaaghtgplhkcdiyqskeagqrlatamklgfsrpwpe
    amqlitgqpnmsasamlsyfkplldwlrtenelhgeklgwpqynwtpns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o86A (A:)
    deaeaskfveeydrtsqvvwneyaeanwnyntnittetskillqknmqianhtlkygtqa
    rkfdvnqlqnttikriikkvqdleraalpaqeleeynkilldmettysvatvchpngscl
    qlepdltnvmatsrkyedllwawegwrdkagrailqfypkyvelinqaarlngyvdagds
    wrsmyetpsleqdlerlfqelqplylnlhayvrralhrhygaqhinlegpipahllgnmw
    aqtwsniydlvvpfpsapsmdtteamlkqgwtprrmfkeaddfftslgllpvppefwnks
    mlekptdgrevvchasawdfyngkdfrikqcttvnledlvvahhemghiqyfmqykdlpv
    alreganpgfheaigdvlalsvstpkhlhslnllssdehdinflmkmaldkiafipfsyl
    vdqwrwrvfdgsitkenynqewwslrlkyqglcppvprtqgdfdpgakfhipssvpyiry
    fvsfiiqfqfhealcqaaghtgplhkcdiyqskeagqrlatamklgfsrpwpeamqlitg
    qpnmsasamlsyfkplldwlrtenelhgeklgwpq