PDB entry 1o7z

View 1o7z on RCSB PDB site
Description: crystal structure of ip-10 t-form
Deposited on 2002-11-20, released 2003-05-08
The last revision prior to the SCOP 1.69 freeze date was dated 2003-05-08, with a file datestamp of 2003-05-08.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.279
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1o7za_
  • Chain 'B':
    Domains in SCOP 1.69: d1o7zb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o7zA (A:)
    vplsrtvrctcisisnqpvnprslekleiipasqfcprveiiatmkkkgekrclnpeska
    iknllkavskemskrsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o7zA (A:)
    ctcisisnqpvnprslekleiipasqfcprveiiatmkkkgekrclnpeskaiknllkav
    s
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o7zB (B:)
    vplsrtvrctcisisnqpvnprslekleiipasqfcprveiiatmkkkgekrclnpeska
    iknllkavskemskrsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o7zB (B:)
    ctcisisnqpvnprslekleiipasqfcprveiiatmkkkgekrclnpeskaiknl