PDB entry 1o7y

View 1o7y on RCSB PDB site
Description: crystal structure of ip-10 m-form
Deposited on 2002-11-20, released 2003-05-08
The last revision prior to the SCOP 1.69 freeze date was dated 2003-05-08, with a file datestamp of 2003-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.267
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1o7ya_
  • Chain 'B':
    Domains in SCOP 1.69: d1o7yb_
  • Chain 'C':
    Domains in SCOP 1.69: d1o7yc_
  • Chain 'D':
    Domains in SCOP 1.69: d1o7yd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o7yA (A:)
    vplsrtvrctcisisnqpvnprslekleiipasqfcprveiiatmkkkgekrclnpeska
    iknllkavskemskrsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o7yA (A:)
    lsrtvrctcisisnqpvnprslekleiipasqfcprveiiatmkkkgekrclnpeskaik
    nllkavsk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o7yB (B:)
    vplsrtvrctcisisnqpvnprslekleiipasqfcprveiiatmkkkgekrclnpeska
    iknllkavskemskrsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o7yB (B:)
    ctcisisnqpvnprslekleiipasqfcprveiiatmkkkgekrclnpeskaiknllkav
    ske
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1o7yC (C:)
    vplsrtvrctcisisnqpvnprslekleiipasqfcprveiiatmkkkgekrclnpeska
    iknllkavskemskrsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o7yC (C:)
    vrctcisisnqpvnprslekleiipasqfcprveiiatmkkkgekrclnpeskaiknllk
    avsk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1o7yD (D:)
    vplsrtvrctcisisnqpvnprslekleiipasqfcprveiiatmkkkgekrclnpeska
    iknllkavskemskrsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o7yD (D:)
    rctcisisnqpvnprslekleiipasqfcprveiiatmkkkgekrclnpeskaiknllka
    vsk