PDB entry 1o7v

View 1o7v on RCSB PDB site
Description: high resolution structure of siglec-7
Class: cell adhesion
Keywords: siglec, immunologlobulin-like fold, lectin, sialic acid binding protein, cell adhesion, immune system
Deposited on 2002-11-14, released 2003-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.21
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sialic acid binding Ig-like lectin 7
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1o7va_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1o7vA (A:)
    gqksnrkdysltmqssvtvqegmcvhvrcsfsypvdsqtdsdpvhgywfragndiswkap
    vatnnpawavqeetrdrfhllgdpqtknctlsirdarmsdagryffrmekgnikwnykyd
    qlsvnvt