PDB entry 1o7s

View 1o7s on RCSB PDB site
Description: high resolution structure of siglec-7
Class: cell adhesion
Keywords: siglec, immunoglobulin fold,sialic acid binding protein, lectin,cell adhesion,immune system
Deposited on 2002-11-12, released 2003-03-30
The last revision prior to the SCOP 1.73 freeze date was dated 2003-03-30, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.221
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sialic acid binding Ig-like lectin 7
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1o7sa_
  • Heterogens: NAG, NDG, CYS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o7sA (A:)
    gqksnrkdysltmqssvtvqegmcvhvrcsfsypvdsqtdsdpvhgywfragndiswkap
    vatnnpawavqeetrdrfhllgdpqtknctlsirdarmsdagryffrmekgnikwnykyd
    qlsvnvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o7sA (A:)
    kdysltmqssvtvqegmcvhvrcsfsypvtdsdpvhgywfrakapvatnnpawavqeetr
    drfhllgdpqtknctlsirdarmsdagryffrmekgnikwnykydqlsvnvt