PDB entry 1o7k

View 1o7k on RCSB PDB site
Description: human p47 PX domain complex with sulphates
Class: sh3 domain
Keywords: p47, nadph oxidase, px domain, phospholipid-binding, phosphoinositide-binding, sh3 domain
Deposited on 2002-11-07, released 2002-11-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neutrophil cytosol factor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1O7K (Start-7)
    • Uniprot P14598 (8-130)
    Domains in SCOPe 2.08: d1o7ka1, d1o7ka2
  • Chain 'B':
    Compound: neutrophil cytosol factor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1O7K
    • Uniprot P14598 (Start-130)
    Domains in SCOPe 2.08: d1o7kb_
  • Chain 'C':
    Compound: neutrophil cytosol factor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1O7K
    • Uniprot P14598 (Start-130)
    Domains in SCOPe 2.08: d1o7kc_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o7kA (A:)
    mahhhhhhmgdtfirhiallgfekrfvpsqhyvymflvkwqdlsekvvyrrfteiyefhk
    tlkemfpieagainpenriiphlpapkwfdgqraaenrqgtlteycstlmslptkisrcp
    hlldffkvrpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o7kA (A:)
    hmgdtfirhiallgfekrfvpsqhyvymflvkwqdlsekvvyrrfteiyefhktlkemfp
    ieagainpenriiphlpapkwfdgqraaenrqgtlteycstlmslptkisrcphlldffk
    vrpd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o7kB (B:)
    mahhhhhhmgdtfirhiallgfekrfvpsqhyvymflvkwqdlsekvvyrrfteiyefhk
    tlkemfpieagainpenriiphlpapkwfdgqraaenrqgtlteycstlmslptkisrcp
    hlldffkvrpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o7kB (B:)
    tfirhiallgfekrfvpsqhyvymflvkwqdlsekvvyrrfteiyefhktlkemfpieag
    ainpenriiphlpapkwfdgqraaenrqgtlteycstlmslptkisrcphlldffkvrpd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1o7kC (C:)
    mahhhhhhmgdtfirhiallgfekrfvpsqhyvymflvkwqdlsekvvyrrfteiyefhk
    tlkemfpieagainpenriiphlpapkwfdgqraaenrqgtlteycstlmslptkisrcp
    hlldffkvrpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o7kC (C:)
    tfirhiallgfekrfvpsqhyvymflvkwqdlsekvvyrrfteiyefhktlkemfpieag
    ainpenriiphlpapkwfdgqraaenrqgtlteycstlmslptkisrcphlldffkvrpd