PDB entry 1o7f

View 1o7f on RCSB PDB site
Description: crystal structure of the regulatory domain of epac2
Class: regulation
Keywords: epac2, camp-gef2, camp, campb binding doamin, gef, exchange factor, regulation
Deposited on 2002-11-04, released 2002-11-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.244
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: camp-dependent rap1 guanine-nucleotide exchange factor
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1o7fa1, d1o7fa2, d1o7fa3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o7fA (A:)
    gspgipmvaahaahsqssaewiacldkrplerssedvdiiftrlkgvkafekfhpnllrq
    iclcgyyenlekgitlfrqgdigtnwyavlagsldvkvsetsshqdavtictlgigtafg
    esildntprhativtressellrieqedfkalwekyrqymagllappygvmetgsnndri
    pdkenvpsekilragkilriailsraphmirdrkyhlktyrqccvgtelvdwmiqqtscv
    hsrtqavgmwqvlledgvlnhvdqerhfqdkylfyrfldderedaplpteeekkecdeel
    qdtmlllsqmgpdahmrmilrkppgqrtvddleiiydellhikalshlsttvkrelagvl
    ifeshakggtvlfnqgeegtswyiilkgsvnvviygkgvvctlhegddfgklalvndapr
    aasivlrednchflrvdkedfnrilrdveantvrlkehdqdvlvlekvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o7fA (A:)
    aewiacldkrplerssedvdiiftrlkgvkafekfhpnllrqiclcgyyenlekgitlfr
    qgdigtnwyavlagsldvkvsetsshqdavtictlgigtafgesildntprhativtres
    sellrieqedfkalwekyrqymagllappygvmetvpsekilragkilriailsraphmi
    rdrkyhlktyrqccvgtelvdwmiqqtscvhsrtqavgmwqvlledgvlnhvdqerhfqd
    kylfyrfldderedaplpteeekkecdeelqdtmlllsqmgpdahmrmilrkppgqrtvd
    dleiiydellhikalshlsttvkrelagvlifeshakggtvlfnqgeegtswyiilkgsv
    nvviygkgvvctlhegddfgklalvndapraasivlrednchflrvdkedfnrilrdvea
    n