PDB entry 1o7d

View 1o7d on RCSB PDB site
Description: the structure of the bovine lysosomal a-mannosidase suggests a novel mechanism for low ph activation
Class: hydrolase
Keywords: hydrolase, glycosyl hydrolase family 38, a-mannosidase, lysosomal
Deposited on 2002-10-30, released 2003-03-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.257
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysosomal alpha-mannosidase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q29451
      • conflict see remark 9 (125)
    Domains in SCOPe 2.03: d1o7d.3
  • Chain 'B':
    Compound: lysosomal alpha-mannosidase
    Species: Bos taurus [TaxId:9913]
    Domains in SCOPe 2.03: d1o7d.1, d1o7d.3
  • Chain 'C':
    Compound: lysosomal alpha-mannosidase
    Species: Bos taurus [TaxId:9913]
    Domains in SCOPe 2.03: d1o7d.1, d1o7d.2
  • Chain 'D':
    Compound: lysosomal alpha-mannosidase
    Species: Bos taurus [TaxId:9913]
    Domains in SCOPe 2.03: d1o7d.2
  • Chain 'E':
    Compound: lysosomal alpha-mannosidase
    Species: Bos taurus [TaxId:9913]
    Domains in SCOPe 2.03: d1o7d.2
  • Heterogens: NAG, TRS, ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o7dA (A:)
    agyktcpkvkpdmlnvhlvphthddvgwlktvdqyfygiynniqpagvqyildsvissll
    anptrrfiyveiaffsrwwrqqtnatqkivrelvrqgrlefanggwvmndeatthygaii
    dqmtlglrfleetfgsdgrprvawhidpfghsreqaslfaqmgfdgfffgrldyqdkkvr
    kktlqmeqvwrastslkpptadlftsvlpnmynppeglcwdmlcadkpvvedtrspeyna
    kelvryflklatdqgklyrtkhtvmtmgsdfqyenantwfknldkliqlvnaqqrang
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o7dA (A:)
    gyktcpkvkpdmlnvhlvphthddvgwlktvdqyfygiynniqpagvqyildsvisslla
    nptrrfiyveiaffsrwwrqqtnatqkivrelvrqgrlefanggwvmndeatthygaiid
    qmtlglrfleetfgsdgrprvawhidpfghsreqaslfaqmgfdgfffgrldyqdkkvrk
    ktlqmeqvwrastslkpptadlftsvlpnmynppeglcwdmlcadkpvvedtrspeynak
    elvryflklatdqgklyrtkhtvmtmgsdfqyenantwfknldkliqlvnaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o7dB (B:)
    irvnvlystpacylwelnkanlswsvkkddffpyadgpymfwtgyfssrpalkryerlsy
    nflqvcnqlealagpaanvgpygs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o7dB (B:)
    irvnvlystpacylwelnkanlswsvkkddffpyadgpymfwtgyfssrpalkryerlsy
    nflqvcnqlealagpa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1o7dC (C:)
    gdsaplneamavlqhhdavsgtsrqhvandyarqlsegwrpcevlmsnalahlsglkedf
    afcrklnisicpltqtaerfqvivynplgrkvdwmvrlpvskhvylvkdpggkivpsdvv
    tipssdsqellfsalvpavgfsiysvsqmpnqrpqksws
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o7dC (C:)
    gdsaplneamavlqhhdavsgtsrqhvandyarqlsegwrpcevlmsnalahlsglkedf
    afcrklnisicpltqtaerfqvivynplgrkvdwmvrlpvskhvylvkdpggkivpsdvv
    tipssdsqellfsalvpavgfsiysvsqmpn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1o7dD (D:)
    rdlviqneylrarfdpntgllmelenleqnlllpvrqafywynastgnnlssqasgayif
    rpnqnkplfvshwaqthlvkaslvqevhqnfsawcsqvvrlyprqrhlelewtvgpipvg
    dgwgkevisrfdtalatrglfytdsngreilerrrnyrptwklnqtepvagnyypvnsri
    yitdgnmqltvltdrsqggsslrdgslelmvhrrllkddargvgeplnkegsglwvrgrh
    lvlldkketaaarhrlqaemevlapqvvlaqgggaryrleka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o7dD (D:)
    rdlviqneylrarfdpntgllmelenllllpvrqafywynastgnnlssqasgayifrpn
    qnkplfvshwaqthlvkaslvqevhqnfsawcsqvvrlyprqrhlelewtvgpipvgdgw
    gkevisrfdtalatrglfytdsngreilerrrnyrptwklnqtepvagnyypvnsriyit
    dgnmqltvltdrsqggsslrdgslelmvhrrllkddargvgeplnkegsglwvrgrhlvl
    ldkketaaarhrlqaemevlapqvvlaqgg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1o7dE (E:)
    prtqfsglrrelppsvrlltlarwgpetlllrlehqfavgedsgrnlsspvtldltnlfs
    aftitnlrettlaanqllayasrlqwttdtgptphpspsrpvsatitlqpmeirtflasv
    qweedg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o7dE (E:)
    prtqfsglrrelppsvrlltlarwgpetlllrlehqfavgedsgrnlsspvtldltnlfs
    aftitnlrettlaanqllayasrlqwttdatitlqpmeirtflasvqwe