PDB entry 1o77

View 1o77 on RCSB PDB site
Description: crystal structure of the c713s mutant of the tir domain of human tlr2
Class: immune system/membrane protein
Keywords: immune system/membrane protein, known biological activity receptor, immune response, inflammatory response, signal, transmembrane, repeat, leucine-rich repeat, glycoprotein, 3d-structure.
Deposited on 2002-10-24, released 2002-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.249
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: toll-like receptor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60603 (0-145)
      • engineered mutation (74)
    Domains in SCOPe 2.07: d1o77a_
  • Chain 'B':
    Compound: toll-like receptor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60603 (0-145)
      • engineered mutation (74)
    Domains in SCOPe 2.07: d1o77b_
  • Chain 'C':
    Compound: toll-like receptor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60603 (0-145)
      • engineered mutation (74)
    Domains in SCOPe 2.07: d1o77c_
  • Chain 'D':
    Compound: toll-like receptor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60603 (0-145)
      • engineered mutation (74)
    Domains in SCOPe 2.07: d1o77d_
  • Chain 'E':
    Compound: toll-like receptor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60603 (0-145)
      • engineered mutation (74)
    Domains in SCOPe 2.07: d1o77e_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o77A (A:)
    icydafvsyserdaywvenlmvqelenfnppfklclhkrdfipgkwiidniidsiekshk
    tvfvlsenfvksewskyeldfshfrlfdenndaailillepiekkaipqrfcklrkimnt
    ktylewpmdeaqregfwvnlraaiks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o77A (A:)
    icydafvsyserdaywvenlmvqelenfnppfklclhkrdfipgkwiidniidsiekshk
    tvfvlsenfvksewskyeldfshfrlfaailillepiekkaipqrfcklrkimntktyle
    wpmdeaqregfwvnlraaiks
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o77B (B:)
    icydafvsyserdaywvenlmvqelenfnppfklclhkrdfipgkwiidniidsiekshk
    tvfvlsenfvksewskyeldfshfrlfdenndaailillepiekkaipqrfcklrkimnt
    ktylewpmdeaqregfwvnlraaiks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o77B (B:)
    icydafvsyserdaywvenlmvqelenfnppfklclhkrdfipgkwiidniidsiekshk
    tvfvlsenfvksewskyellfaailillepiekkaipqrfcklrkimntktylewpmdea
    qregfwvnlraaiks
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1o77C (C:)
    icydafvsyserdaywvenlmvqelenfnppfklclhkrdfipgkwiidniidsiekshk
    tvfvlsenfvksewskyeldfshfrlfdenndaailillepiekkaipqrfcklrkimnt
    ktylewpmdeaqregfwvnlraaiks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o77C (C:)
    icydafvsyserdaywvenlmvqelenfnppfklclhkrdfipgkwiidniidsiekshk
    tvfvlsenfvksewskyeldfaailillepiekkaipqrfcklrkimntktylewpmdea
    qregfwvnlraaiks
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1o77D (D:)
    icydafvsyserdaywvenlmvqelenfnppfklclhkrdfipgkwiidniidsiekshk
    tvfvlsenfvksewskyeldfshfrlfdenndaailillepiekkaipqrfcklrkimnt
    ktylewpmdeaqregfwvnlraaiks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o77D (D:)
    icydafvsyserdaywvenlmvqelenfnppfklclhkrdfipgkwiidniidsiekshk
    tvfvlsenfvksewskyeldfshfrlfaailillepiekkaipqrfcklrkimntktyle
    wpmdeaqregfwvnlraaiks
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1o77E (E:)
    icydafvsyserdaywvenlmvqelenfnppfklclhkrdfipgkwiidniidsiekshk
    tvfvlsenfvksewskyeldfshfrlfdenndaailillepiekkaipqrfcklrkimnt
    ktylewpmdeaqregfwvnlraaiks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o77E (E:)
    icydafvsyserdaywvenlmvqelenfnppfklclhkrdfipgkwiidniidsiekshk
    tvfvlsenfvksewskyeldflfaailillepiekkaipqrfcklrkimntktylewpmd
    eaqregfwvnlraaiks