PDB entry 1o6y

View 1o6y on RCSB PDB site
Description: Catalytic domain of PknB kinase from Mycobacterium tuberculosis
Class: transferase
Keywords: serine/threonine protein kinase, transferase, psi, protein structure initiative, tb structural genomics consortium, tb, tbsgc
Deposited on 2002-10-21, released 2003-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-24, with a file datestamp of 2017-05-19.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase pknb
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1o6ya_
  • Heterogens: ACP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o6yA (A:)
    mgsshhhhhhssglvprgshmttpshlsdryelgeilgfggmsevhlardlrlhrdvavk
    vlradlardpsfylrfrreaqnaaalnhpaivavydtgeaetpagplpyivmeyvdgvtl
    rdivhtegpmtpkraieviadacqalnfshqngiihrdvkpanimisatnavkvmdfgia
    raiadsgnsvtqtaavigtaqylspeqargdsvdarsdvyslgcvlyevltgeppftgds
    pvsvayqhvredpippsarheglsadldavvlkalaknpenryqtaaemradlvrvhng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o6yA (A:)
    tpshlsdryelgeilgfggmsevhlardlrlhrdvavkvlradlardpsfylrfrreaqn
    aaalnhpaivavydtgeaetpagplpyivmeyvdgvtlrdivhtegpmtpkraieviada
    cqalnfshqngiihrdvkpanimisatnavkvmdfgiaraiaqylspeqargdsvdarsd
    vyslgcvlyevltgeppftgdspvsvayqhvredpippsarheglsadldavvlkalakn
    penryqtaaemradlvrvhn