PDB entry 1o6y

View 1o6y on RCSB PDB site
Description: catalytic domain of pknb kinase from mycobacterium tuberculosis
Deposited on 2002-10-21, released 2003-01-30
The last revision prior to the SCOP 1.63 freeze date was dated 2003-01-30, with a file datestamp of 2003-01-30.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.1927
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1o6ya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o6yA (A:)
    tpshlsdryelgeilgfggmsevhlardlrlhrdvavkvlradlardpsfylrfrreaqn
    aaalnhpaivavydtgeaetpagplpyivmeyvdgvtlrdivhtegpmtpkraieviada
    cqalnfshqngiihrdvkpanimisatnavkvmdfgiaraiadsgnsvtqtaavigtaqy
    lspeqargdsvdarsdvyslgcvlyevltgeppftgdspvsvayqhvredpippsarheg
    lsadldavvlkalaknpenryqtaaemradlvrvhng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o6yA (A:)
    tpshlsdryelgeilgfggmsevhlardlrlhrdvavkvlradlardpsfylrfrreaqn
    aaalnhpaivavydtgeaetpagplpyivmeyvdgvtlrdivhtegpmtpkraieviada
    cqalnfshqngiihrdvkpanimisatnavkvmdfgiaraiaqylspeqargdsvdarsd
    vyslgcvlyevltgeppftgdspvsvayqhvredpippsarheglsadldavvlkalakn
    penryqtaaemradlvrvhng