PDB entry 1o6x

View 1o6x on RCSB PDB site
Description: nmr solution structure of the activation domain of human procarboxypeptidase a2
Class: hydrolase
Keywords: activation domain, hydrolase, carboxypeptidase, metalloprote
Deposited on 2002-10-17, released 2003-01-30
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: procarboxypeptidase a2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1O6X (0-2)
    • Uniprot P48052 (3-80)
    Domains in SCOPe 2.04: d1o6xa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1o6xA (A:)
    mrsletfvgdqvleivpsneeqiknllqleaqehlqldfwkspttpgetahvrvpfvnvq
    avkvflesqgiaysimiedvq