PDB entry 1o6w

View 1o6w on RCSB PDB site
Description: solution structure of the prp40 ww domain pair of the yeast splicing factor prp40
Class: nuclear protein
Keywords: ww domain pair, nuclear protein, mRNA processing, prp40, mRNA splicing, ribonucleoprotein
Deposited on 2002-10-16, released 2002-12-04
The last revision prior to the SCOP 1.73 freeze date was dated 2002-12-04, with a file datestamp of 2007-07-20.
Experiment type: NMR7
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Pre-mRNA processing protein PRP40
  Species: SACCHAROMYCES CEREVISIAE
  Database cross-references and differences (RAF-indexed):
  • Uniprot P33203 (0-74)
  Domains in SCOP 1.73: d1o6wa1, d1o6wa2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1o6wA (A:)
  msiwkeakdasgriyyyntltkkstwekpkelisqeelllrengwkaaktadgkvyyynp
  ttretswtipafekk