PDB entry 1o6p

View 1o6p on RCSB PDB site
Description: importin beta bound to a glfg nucleoporin peptide
Class: nuclear transport
Keywords: nuclear transport, nuclear trafficking, nucleoporin, transport factor, repeat, protein transport
Deposited on 2002-10-10, released 2003-04-24
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.238
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: importin beta-1 subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14974 (0-End)
      • conflict (96)
    Domains in SCOPe 2.04: d1o6pa_
  • Chain 'B':
    Compound: importin beta-1 subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14974 (0-End)
      • conflict (96)
    Domains in SCOPe 2.04: d1o6pb_
  • Chain 'C':
    Compound: synthetic glfg peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 1O6P
  • Chain 'D':
    Compound: synthetic glfg peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 1O6P
  • Chain 'E':
    Compound: synthetic glfg peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 1O6P
  • Chain 'F':
    Compound: synthetic glfg peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 1O6P
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o6pA (A:)
    melitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglq
    iknsltskdpdikaqyqqrwlaidanarrevknyvlhtlgtetyrpssasqcvagiacae
    ipvnqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqg
    mrkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqn
    lvkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieasea
    aeqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllatcce
    ddivphvlpfikehiknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdp
    svvvrdtaawtvgricellpea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o6pA (A:)
    melitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglq
    iknsltskdpdikaqyqqrwlaidanarrevknyvlhtlgtetyrpssasqcvagiacae
    ipvnqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqg
    mrkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqn
    lvkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieasea
    aeqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllatcce
    ddivphvlpfikehiknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdp
    svvvrdtaawtvgricellpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o6pB (B:)
    melitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglq
    iknsltskdpdikaqyqqrwlaidanarrevknyvlhtlgtetyrpssasqcvagiacae
    ipvnqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqg
    mrkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqn
    lvkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieasea
    aeqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllatcce
    ddivphvlpfikehiknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdp
    svvvrdtaawtvgricellpea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o6pB (B:)
    melitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglq
    iknsltskdpdikaqyqqrwlaidanarrevknyvlhtlgtetyrpssasqcvagiacae
    ipvnqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqg
    mrkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqn
    lvkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieasea
    aeqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllatcce
    ddivphvlpfikehiknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdp
    svvvrdtaawtvgricellpe
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.