PDB entry 1o6b

View 1o6b on RCSB PDB site
Description: Crystal structure of phosphopantetheine adenylyltransferase with ADP
Class: Transferase
Keywords: structural genomics, Transferase
Deposited on 2003-11-03, released 2003-11-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.229
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphopantetheine adenylyltransferase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: COAD, BSU15020
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34797 (1-160)
      • variant (78)
      • modified residue (99)
      • modified residue (117-118)
      • variant (119)
      • variant (138)
      • cloning artifact (161-163)
    Domains in SCOPe 2.05: d1o6ba_
  • Heterogens: PO4, MG, CL, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1o6bA (A:)
masiavcpgsfdpvtyghldiikrgahifeqvyvcvlnnsskkplfsveercellrevtk
dipnitvetsqgllidyarrknakailrglravsdfeyemqgtsvnrvldesietffmma
nnqysflsssivkevarydgsvsefvppevelalqqkfrqggshhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >1o6bA (A:)
asiavcpgsfdpvtyghldiikrgahifeqvyvcvlnnsskkplfsveercellrevtkd
ipnitvetsqgllidyarrknakailrglravsdfeyemqgtsvnrvldesietffmman
nqysflsssivkevarydgsvsefvppevelalqqkfrqggsh