PDB entry 1o68

View 1o68 on RCSB PDB site
Description: crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase
Deposited on 2003-10-23, released 2003-11-11
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-30, with a file datestamp of 2003-12-30.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.186
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1o68a_
  • Chain 'B':
    Domains in SCOP 1.67: d1o68b_
  • Chain 'C':
    Domains in SCOP 1.67: d1o68c_
  • Chain 'D':
    Domains in SCOP 1.67: d1o68d_
  • Chain 'E':
    Domains in SCOP 1.67: d1o68e_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o68A (A:)
    mslitvntlqkmkaagekiamltayessfaalmddagvemllvgdslgmavqgrkstlpv
    slrdmcyhtecvargaknamivsdlpfgayqqskeqafaaaaelmaagahmvkleggvwm
    aetteflqmrgipvcahigltpqsvfafggykvqgrggkaqallndakahddagaavvlm
    ecvlaelakkvtetvscptigigagadcdgqvlvmhdmlgifpgktakfvknfmqghdsv
    qaavrayvaevkaktfpaaehifadeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o68A (A:)
    litvntlqkmkaagekiamltayessfaalmddagvemllvgdslgmavqgrkstlpvsl
    rdmcyhtecvargaknamivsdlpfgayqqskeqafaaaaelmaagahmvkleggvwmae
    tteflqmrgipvcahigltpqsvfakaqallndakahddagaavvlmecvlaelakkvte
    tvscptigigagadcdgqvlvmhdmlgifpgktakfvknfmqghdsvqaavrayvaevka
    ktfpaaehif
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o68B (B:)
    mslitvntlqkmkaagekiamltayessfaalmddagvemllvgdslgmavqgrkstlpv
    slrdmcyhtecvargaknamivsdlpfgayqqskeqafaaaaelmaagahmvkleggvwm
    aetteflqmrgipvcahigltpqsvfafggykvqgrggkaqallndakahddagaavvlm
    ecvlaelakkvtetvscptigigagadcdgqvlvmhdmlgifpgktakfvknfmqghdsv
    qaavrayvaevkaktfpaaehifadeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o68B (B:)
    slitvntlqkmkaagekiamltayessfaalmddagvemllvgdslgmavqgrkstlpvs
    lrdmcyhtecvargaknamivsdlpfgayqqskeqafaaaaelmaagahmvkleggvwma
    etteflqmrgipvcahigltpqsvfafggykvqgrggkaqallndakahddagaavvlme
    cvlaelakkvtetvscptigigagadcdgqvlvmhdmlgifpgktakfvknfmqghdsvq
    aavrayvaevkaktfpaaehif
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1o68C (C:)
    mslitvntlqkmkaagekiamltayessfaalmddagvemllvgdslgmavqgrkstlpv
    slrdmcyhtecvargaknamivsdlpfgayqqskeqafaaaaelmaagahmvkleggvwm
    aetteflqmrgipvcahigltpqsvfafggykvqgrggkaqallndakahddagaavvlm
    ecvlaelakkvtetvscptigigagadcdgqvlvmhdmlgifpgktakfvknfmqghdsv
    qaavrayvaevkaktfpaaehifadeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o68C (C:)
    slitvntlqkmkaagekiamltayessfaalmddagvemllvgdslgmavqgrkstlpvs
    lrdmcyhtecvargaknamivsdlpfgayqqskeqafaaaaelmaagahmvkleggvwma
    etteflqmrgipvcahigltpqsvfakaqallndakahddagaavvlmecvlaelakkvt
    etvscptigigagadcdgqvlvmhdmlgifpgktakfvknfmqghdsvqaavrayvaevk
    aktfpa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1o68D (D:)
    mslitvntlqkmkaagekiamltayessfaalmddagvemllvgdslgmavqgrkstlpv
    slrdmcyhtecvargaknamivsdlpfgayqqskeqafaaaaelmaagahmvkleggvwm
    aetteflqmrgipvcahigltpqsvfafggykvqgrggkaqallndakahddagaavvlm
    ecvlaelakkvtetvscptigigagadcdgqvlvmhdmlgifpgktakfvknfmqghdsv
    qaavrayvaevkaktfpaaehifadeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o68D (D:)
    slitvntlqkmkaagekiamltayessfaalmddagvemllvgdslgmavqgrkstlpvs
    lrdmcyhtecvargaknamivsdlpfgayqqskeqafaaaaelmaagahmvkleggvwma
    etteflqmrgipvcahigltpqsvfafggykvqgrggkaqallndakahddagaavvlme
    cvlaelakkvtetvscptigigagadcdgqvlvmhdmlgifpgktakfvknfmqghdsvq
    aavrayvaevkaktfpaaehif
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1o68E (E:)
    mslitvntlqkmkaagekiamltayessfaalmddagvemllvgdslgmavqgrkstlpv
    slrdmcyhtecvargaknamivsdlpfgayqqskeqafaaaaelmaagahmvkleggvwm
    aetteflqmrgipvcahigltpqsvfafggykvqgrggkaqallndakahddagaavvlm
    ecvlaelakkvtetvscptigigagadcdgqvlvmhdmlgifpgktakfvknfmqghdsv
    qaavrayvaevkaktfpaaehifadeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o68E (E:)
    slitvntlqkmkaagekiamltayessfaalmddagvemllvgdslgmavqgrkstlpvs
    lrdmcyhtecvargaknamivsdlpfgayqqskeqafaaaaelmaagahmvkleggvwma
    etteflqmrgipvcahigltpqsvfaaqallndakahddagaavvlmecvlaelakkvte
    tvscptigigagadcdgqvlvmhdmlgifpgktakfvknfmqghdsvqaavrayvaevka
    ktfpaaehi