PDB entry 1o68

View 1o68 on RCSB PDB site
Description: Crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase
Class: transferase
Keywords: structural genomics, transferase
Deposited on 2003-10-23, released 2003-11-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
    Species: NEISSERIA MENINGITIDIS [TaxId:491]
    Gene: PANB, NMB0870
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JZW6 (3-End)
      • cloning artifact (2)
      • modified residue (11)
      • modified residue (20)
      • modified residue (32)
      • modified residue (39)
      • modified residue (48)
      • modified residue (64)
      • modified residue (79)
      • modified residue (104)
      • modified residue (110)
      • modified residue (119)
      • modified residue (128)
      • modified residue (179)
      • modified residue (214)
      • modified residue (217)
      • modified residue (233)
    Domains in SCOPe 2.08: d1o68a1, d1o68a2
  • Chain 'B':
    Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
    Species: NEISSERIA MENINGITIDIS [TaxId:491]
    Gene: PANB, NMB0870
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JZW6 (3-End)
      • cloning artifact (1-2)
      • modified residue (11)
      • modified residue (20)
      • modified residue (32)
      • modified residue (39)
      • modified residue (48)
      • modified residue (64)
      • modified residue (79)
      • modified residue (104)
      • modified residue (110)
      • modified residue (119)
      • modified residue (128)
      • modified residue (179)
      • modified residue (214)
      • modified residue (217)
      • modified residue (233)
    Domains in SCOPe 2.08: d1o68b1, d1o68b2
  • Chain 'C':
    Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
    Species: NEISSERIA MENINGITIDIS [TaxId:491]
    Gene: PANB, NMB0870
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JZW6 (3-End)
      • cloning artifact (1-2)
      • modified residue (11)
      • modified residue (20)
      • modified residue (32)
      • modified residue (39)
      • modified residue (48)
      • modified residue (64)
      • modified residue (79)
      • modified residue (104)
      • modified residue (110)
      • modified residue (119)
      • modified residue (128)
      • modified residue (179)
      • modified residue (214)
      • modified residue (217)
      • modified residue (233)
    Domains in SCOPe 2.08: d1o68c1, d1o68c2
  • Chain 'D':
    Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
    Species: NEISSERIA MENINGITIDIS [TaxId:491]
    Gene: PANB, NMB0870
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JZW6 (3-End)
      • cloning artifact (1-2)
      • modified residue (11)
      • modified residue (20)
      • modified residue (32)
      • modified residue (39)
      • modified residue (48)
      • modified residue (64)
      • modified residue (79)
      • modified residue (104)
      • modified residue (110)
      • modified residue (119)
      • modified residue (128)
      • modified residue (179)
      • modified residue (214)
      • modified residue (217)
      • modified residue (233)
    Domains in SCOPe 2.08: d1o68d1, d1o68d2
  • Chain 'E':
    Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
    Species: NEISSERIA MENINGITIDIS [TaxId:491]
    Gene: PANB, NMB0870
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JZW6 (3-End)
      • cloning artifact (1-2)
      • modified residue (11)
      • modified residue (20)
      • modified residue (32)
      • modified residue (39)
      • modified residue (48)
      • modified residue (64)
      • modified residue (79)
      • modified residue (104)
      • modified residue (110)
      • modified residue (119)
      • modified residue (128)
      • modified residue (179)
      • modified residue (214)
      • modified residue (217)
      • modified residue (233)
    Domains in SCOPe 2.08: d1o68e1, d1o68e2
  • Heterogens: NA, KIV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o68A (A:)
    mslitvntlqkmkaagekiamltayessfaalmddagvemllvgdslgmavqgrkstlpv
    slrdmcyhtecvargaknamivsdlpfgayqqskeqafaaaaelmaagahmvkleggvwm
    aetteflqmrgipvcahigltpqsvfafggykvqgrggkaqallndakahddagaavvlm
    ecvlaelakkvtetvscptigigagadcdgqvlvmhdmlgifpgktakfvknfmqghdsv
    qaavrayvaevkaktfpaaehifadeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o68A (A:)
    litvntlqkmkaagekiamltayessfaalmddagvemllvgdslgmavqgrkstlpvsl
    rdmcyhtecvargaknamivsdlpfgayqqskeqafaaaaelmaagahmvkleggvwmae
    tteflqmrgipvcahigltpqsvfakaqallndakahddagaavvlmecvlaelakkvte
    tvscptigigagadcdgqvlvmhdmlgifpgktakfvknfmqghdsvqaavrayvaevka
    ktfpaaehif
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o68B (B:)
    mslitvntlqkmkaagekiamltayessfaalmddagvemllvgdslgmavqgrkstlpv
    slrdmcyhtecvargaknamivsdlpfgayqqskeqafaaaaelmaagahmvkleggvwm
    aetteflqmrgipvcahigltpqsvfafggykvqgrggkaqallndakahddagaavvlm
    ecvlaelakkvtetvscptigigagadcdgqvlvmhdmlgifpgktakfvknfmqghdsv
    qaavrayvaevkaktfpaaehifadeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o68B (B:)
    slitvntlqkmkaagekiamltayessfaalmddagvemllvgdslgmavqgrkstlpvs
    lrdmcyhtecvargaknamivsdlpfgayqqskeqafaaaaelmaagahmvkleggvwma
    etteflqmrgipvcahigltpqsvfafggykvqgrggkaqallndakahddagaavvlme
    cvlaelakkvtetvscptigigagadcdgqvlvmhdmlgifpgktakfvknfmqghdsvq
    aavrayvaevkaktfpaaehif
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1o68C (C:)
    mslitvntlqkmkaagekiamltayessfaalmddagvemllvgdslgmavqgrkstlpv
    slrdmcyhtecvargaknamivsdlpfgayqqskeqafaaaaelmaagahmvkleggvwm
    aetteflqmrgipvcahigltpqsvfafggykvqgrggkaqallndakahddagaavvlm
    ecvlaelakkvtetvscptigigagadcdgqvlvmhdmlgifpgktakfvknfmqghdsv
    qaavrayvaevkaktfpaaehifadeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o68C (C:)
    slitvntlqkmkaagekiamltayessfaalmddagvemllvgdslgmavqgrkstlpvs
    lrdmcyhtecvargaknamivsdlpfgayqqskeqafaaaaelmaagahmvkleggvwma
    etteflqmrgipvcahigltpqsvfakaqallndakahddagaavvlmecvlaelakkvt
    etvscptigigagadcdgqvlvmhdmlgifpgktakfvknfmqghdsvqaavrayvaevk
    aktfpa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1o68D (D:)
    mslitvntlqkmkaagekiamltayessfaalmddagvemllvgdslgmavqgrkstlpv
    slrdmcyhtecvargaknamivsdlpfgayqqskeqafaaaaelmaagahmvkleggvwm
    aetteflqmrgipvcahigltpqsvfafggykvqgrggkaqallndakahddagaavvlm
    ecvlaelakkvtetvscptigigagadcdgqvlvmhdmlgifpgktakfvknfmqghdsv
    qaavrayvaevkaktfpaaehifadeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o68D (D:)
    slitvntlqkmkaagekiamltayessfaalmddagvemllvgdslgmavqgrkstlpvs
    lrdmcyhtecvargaknamivsdlpfgayqqskeqafaaaaelmaagahmvkleggvwma
    etteflqmrgipvcahigltpqsvfafggykvqgrggkaqallndakahddagaavvlme
    cvlaelakkvtetvscptigigagadcdgqvlvmhdmlgifpgktakfvknfmqghdsvq
    aavrayvaevkaktfpaaehif
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1o68E (E:)
    mslitvntlqkmkaagekiamltayessfaalmddagvemllvgdslgmavqgrkstlpv
    slrdmcyhtecvargaknamivsdlpfgayqqskeqafaaaaelmaagahmvkleggvwm
    aetteflqmrgipvcahigltpqsvfafggykvqgrggkaqallndakahddagaavvlm
    ecvlaelakkvtetvscptigigagadcdgqvlvmhdmlgifpgktakfvknfmqghdsv
    qaavrayvaevkaktfpaaehifadeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o68E (E:)
    slitvntlqkmkaagekiamltayessfaalmddagvemllvgdslgmavqgrkstlpvs
    lrdmcyhtecvargaknamivsdlpfgayqqskeqafaaaaelmaagahmvkleggvwma
    etteflqmrgipvcahigltpqsvfaaqallndakahddagaavvlmecvlaelakkvte
    tvscptigigagadcdgqvlvmhdmlgifpgktakfvknfmqghdsvqaavrayvaevka
    ktfpaaehi