PDB entry 1o67

View 1o67 on RCSB PDB site
Description: Crystal structure of an hypothetical protein
Class: Structural genomics, unknown function
Keywords: structural genomics, unknown function
Deposited on 2003-10-23, released 2003-11-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.54 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein yiiM
    Species: Escherichia coli [TaxId:562]
    Gene: YIIM, B3910
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32157 (Start-235)
      • modified residue (12)
      • modified residue (44)
      • engineered (111)
      • modified residue (147)
      • modified residue (192)
      • modified residue (216)
      • cloning artifact (236-237)
    Domains in SCOPe 2.08: d1o67a1, d1o67a2
  • Chain 'B':
    Compound: Hypothetical protein yiiM
    Species: Escherichia coli [TaxId:562]
    Gene: YIIM, B3910
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32157 (Start-235)
      • modified residue (12)
      • modified residue (44)
      • engineered (111)
      • modified residue (147)
      • modified residue (192)
      • modified residue (216)
      • cloning artifact (236)
    Domains in SCOPe 2.08: d1o67b1, d1o67b2
  • Chain 'C':
    Compound: Hypothetical protein yiiM
    Species: Escherichia coli [TaxId:562]
    Gene: YIIM, B3910
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32157
      • modified residue (12)
      • modified residue (44)
      • engineered (111)
      • modified residue (147)
      • modified residue (192)
      • modified residue (216)
    Domains in SCOPe 2.08: d1o67c_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o67A (A:)
    mslgkflvereqmrypvdvytgkiqaypegkpsaiakiqvdgelmltelglegdeqaekk
    vhggpdralchyprehylywarefpeqaelfvapafgenlstdgltesnvymgdifrwge
    aliqvsqprspcyklnyhfdisdiaqlmqntgkvgwlysviapgkvsadaplelvsrvsd
    vtvqeaaaiawhmpfdddqyhrllsaaglskswtrtmqkrrlsgkiedfsrrlwgkeggs
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o67A (A:)
    flvereqmrypvdvytgkakiqvdgelmltelglegdeggpdralchyprehylywaref
    peqaelfvapafgenlstdgltesnvymgdifrwgealiqvsqprspcyklnyhfdisdi
    aqlmqntgkvgwlysviapgkvsadaplelvsrvsdvtvqeaaaiawhmpfdddqyhrll
    saaglskswtrtmqkrrlsgkiedfsrrlwgkeg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o67B (B:)
    mslgkflvereqmrypvdvytgkiqaypegkpsaiakiqvdgelmltelglegdeqaekk
    vhggpdralchyprehylywarefpeqaelfvapafgenlstdgltesnvymgdifrwge
    aliqvsqprspcyklnyhfdisdiaqlmqntgkvgwlysviapgkvsadaplelvsrvsd
    vtvqeaaaiawhmpfdddqyhrllsaaglskswtrtmqkrrlsgkiedfsrrlwgkeggs
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o67B (B:)
    flvereqmrypvdvytgakiqvdgelmltelglegdevhggpdralchyprehylyware
    fpeqaelfvapafgenlstdgltesnvymgdifrwgealiqvsqprspcyklnyhfdisd
    iaqlmqntgkvgwlysviapgkvsadaplelvsrvsdvtvqeaaaiawhmpfdddqyhrl
    lsaaglskswtrtmqkrrlsgkiedfsrrlwgke
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1o67C (C:)
    mslgkflvereqmrypvdvytgkiqaypegkpsaiakiqvdgelmltelglegdeqaekk
    vhggpdralchyprehylywarefpeqaelfvapafgenlstdgltesnvymgdifrwge
    aliqvsqprspcyklnyhfdisdiaqlmqntgkvgwlysviapgkvsadaplelvsrvsd
    vtvqeaaaiawhmpfdddqyhrllsaaglskswtrtmqkrrlsgkiedfsrrlwgkeggs
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o67C (C:)
    lvereqmrypvdvytgakiqvdgelmltelglegdeqagpdralchyprehylywarefp
    eqaelfvapafgenlstdgltesnvymgdifrwgealiqvsqprspcyklnyhfdisdia
    qlmqntgkvgwlysviapgkvsadaplelvsrvsdvtvqeaaaiawhmpfdddqyhrlls
    aaglskswtrtmqkrrlsgkiedfsrrlwg