PDB entry 1o65

View 1o65 on RCSB PDB site
Description: Crystal structure of an hypothetical protein
Class: Structural genomics, unknown function
Keywords: structural genomics, unknown function
Deposited on 2003-10-23, released 2003-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.33 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein yiiM
    Species: Escherichia coli [TaxId:562]
    Gene: YIIM, B3910
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32157 (Start-235)
      • cloning artifact (236)
    Domains in SCOPe 2.07: d1o65a1, d1o65a2
  • Chain 'B':
    Compound: Hypothetical protein yiiM
    Species: Escherichia coli [TaxId:562]
    Gene: YIIM, B3910
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1o65b_
  • Chain 'C':
    Compound: Hypothetical protein yiiM
    Species: Escherichia coli [TaxId:562]
    Gene: YIIM, B3910
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32157 (Start-235)
      • cloning artifact (236-238)
    Domains in SCOPe 2.07: d1o65c1, d1o65c2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o65A (A:)
    mslgkflvereqmrypvdvytgkiqaypegkpsaiakiqvdgelmltelglegdeqaekk
    vhggpdralchyprehylywarefpeqaelfvapafgenlstdgltesnvymgdifrwge
    aliqvsqprspcyklnyhfdisdiaqlmqntgkvgwlysviapgkvsadaplelvsrvsd
    vtvqeaaaiawhmpfdddqyhrllsaaglskswtrtmqkrrlsgkiedfsrrlwgkeggs
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o65A (A:)
    kflvereqmrypvdvytgkakiqvdgelmltelglegdeqavhggpdralchyprehyly
    warefpeqaelfvapafgenlstdgltesnvymgdifrwgealiqvsqprspcyklnyhf
    disdiaqlmqntgkvgwlysviapgkvsadaplelvsrvsdvtvqeaaaiawhmpfdddq
    yhrllsaaglskswtrtmqkrrlsgkiedfsrrlwgke
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o65B (B:)
    mslgkflvereqmrypvdvytgkiqaypegkpsaiakiqvdgelmltelglegdeqaekk
    vhggpdralchyprehylywarefpeqaelfvapafgenlstdgltesnvymgdifrwge
    aliqvsqprspcyklnyhfdisdiaqlmqntgkvgwlysviapgkvsadaplelvsrvsd
    vtvqeaaaiawhmpfdddqyhrllsaaglskswtrtmqkrrlsgkiedfsrrlwgkeggs
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o65B (B:)
    kflvereqmrypvdvytgkiakiqvdgelmltelglegdeqaehggpdralchyprehyl
    ywarefpeqaelfvapafgenlstdgltesnvymgdifrwgealiqvsqprspcyklnyh
    fdisdiaqlmqntgkvgwlysviapgkvsadaplelvsrvsdvtvqeaaaiawhmpfddd
    qyhrllsaaglskswtrtmqkrrlsgkiedfsrrlwg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1o65C (C:)
    mslgkflvereqmrypvdvytgkiqaypegkpsaiakiqvdgelmltelglegdeqaekk
    vhggpdralchyprehylywarefpeqaelfvapafgenlstdgltesnvymgdifrwge
    aliqvsqprspcyklnyhfdisdiaqlmqntgkvgwlysviapgkvsadaplelvsrvsd
    vtvqeaaaiawhmpfdddqyhrllsaaglskswtrtmqkrrlsgkiedfsrrlwgkeggs
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o65C (C:)
    kflvereqmrypvdvytgkiakiqvdgelmltelglegdeqgpdralchyprehylywar
    efpeqaelfvapafgenlstdgltesnvymgdifrwgealiqvsqprspcyklnyhfdis
    diaqlmqntgkvgwlysviapgkvsadaplelvsrvsdvtvqeaaaiawhmpfdddqyhr
    llsaaglskswtrtmqkrrlsgkiedfsrrlwgkegg