PDB entry 1o60

View 1o60 on RCSB PDB site
Description: Crystal structure of KDO-8-phosphate synthase
Class: transferase
Keywords: structural genomics, transferase
Deposited on 2003-10-23, released 2003-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-dehydro-3-deoxyphosphooctonate aldolase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: KDSA, HI1557
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45251
      • modified residue (24)
      • modified residue (32)
      • modified residue (34)
      • modified residue (73)
      • modified residue (127)
      • modified residue (147)
      • modified residue (180)
      • modified residue (186)
      • modified residue (266)
    Domains in SCOPe 2.07: d1o60a_
  • Chain 'B':
    Compound: 2-dehydro-3-deoxyphosphooctonate aldolase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: KDSA, HI1557
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45251
      • modified residue (24)
      • modified residue (32)
      • modified residue (34)
      • modified residue (73)
      • modified residue (127)
      • modified residue (147)
      • modified residue (180)
      • modified residue (186)
      • modified residue (266)
    Domains in SCOPe 2.07: d1o60b_
  • Chain 'C':
    Compound: 2-dehydro-3-deoxyphosphooctonate aldolase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: KDSA, HI1557
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45251
      • modified residue (24)
      • modified residue (32)
      • modified residue (34)
      • modified residue (73)
      • modified residue (127)
      • modified residue (147)
      • modified residue (180)
      • modified residue (186)
      • modified residue (266)
    Domains in SCOPe 2.07: d1o60c_
  • Chain 'D':
    Compound: 2-dehydro-3-deoxyphosphooctonate aldolase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: KDSA, HI1557
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45251
      • modified residue (24)
      • modified residue (32)
      • modified residue (34)
      • modified residue (73)
      • modified residue (127)
      • modified residue (147)
      • modified residue (180)
      • modified residue (186)
      • modified residue (266)
    Domains in SCOPe 2.07: d1o60d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o60A (A:)
    mqnkivkignidvandkpfvlfggmnvlesrdmamqvceayvkvteklgvpyvfkasfdk
    anrssihsyrgpgmeeglkifqelkdtfgvkiitdvheiyqcqpvadvvdiiqlpaflar
    qtdlveamaktgavinvkkpqflspsqmgnivekieecgndkiilcdrgtnfgydnlivd
    mlgfsvmkkaskgspvifdvthslqcrdpfgaassgrraqvtelarsglavgiaglflea
    hpnpnqakcdgpsalplsalegfvsqmkaiddlvksfpeldtsigshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o60A (A:)
    qnkivkignidvandkpfvlfggmnvlesrdmamqvceayvkvteklgvpyvfkasfdka
    nrssihsyrgpgmeeglkifqelkdtfgvkiitdvheiyqcqpvadvvdiiqlpaflarq
    tdlveamaktgavinvkkpqflspsqmgnivekieecgndkiilcdrgtnfgydnlivdm
    lgfsvmkkaskgspvifdvthslqraqvtelarsglavgiaglfleahpnpnqakcdgps
    alplsalegfvsqmkaiddlvksfpeldt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o60B (B:)
    mqnkivkignidvandkpfvlfggmnvlesrdmamqvceayvkvteklgvpyvfkasfdk
    anrssihsyrgpgmeeglkifqelkdtfgvkiitdvheiyqcqpvadvvdiiqlpaflar
    qtdlveamaktgavinvkkpqflspsqmgnivekieecgndkiilcdrgtnfgydnlivd
    mlgfsvmkkaskgspvifdvthslqcrdpfgaassgrraqvtelarsglavgiaglflea
    hpnpnqakcdgpsalplsalegfvsqmkaiddlvksfpeldtsigshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o60B (B:)
    qnkivkignidvandkpfvlfggmnvlesrdmamqvceayvkvteklgvpyvfkasfdka
    nrssihsyrgpgmeeglkifqelkdtfgvkiitdvheiyqcqpvadvvdiiqlpaflarq
    tdlveamaktgavinvkkpqflspsqmgnivekieecgndkiilcdrgtnfgydnlivdm
    lgfsvmkkaskgspvifdvthslqraqvtelarsglavgiaglfleahpnpnqakcdgps
    alplsalegfvsqmkaiddlvksfpeldt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1o60C (C:)
    mqnkivkignidvandkpfvlfggmnvlesrdmamqvceayvkvteklgvpyvfkasfdk
    anrssihsyrgpgmeeglkifqelkdtfgvkiitdvheiyqcqpvadvvdiiqlpaflar
    qtdlveamaktgavinvkkpqflspsqmgnivekieecgndkiilcdrgtnfgydnlivd
    mlgfsvmkkaskgspvifdvthslqcrdpfgaassgrraqvtelarsglavgiaglflea
    hpnpnqakcdgpsalplsalegfvsqmkaiddlvksfpeldtsigshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o60C (C:)
    qnkivkignidvandkpfvlfggmnvlesrdmamqvceayvkvteklgvpyvfkasfdka
    nrssihsyrgpgmeeglkifqelkdtfgvkiitdvheiyqcqpvadvvdiiqlpaflarq
    tdlveamaktgavinvkkpqflspsqmgnivekieecgndkiilcdrgtnfgydnlivdm
    lgfsvmkkaskgspvifdvthslqraqvtelarsglavgiaglfleahpnpnqakcdgps
    alplsalegfvsqmkaiddlvksfpeldt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1o60D (D:)
    mqnkivkignidvandkpfvlfggmnvlesrdmamqvceayvkvteklgvpyvfkasfdk
    anrssihsyrgpgmeeglkifqelkdtfgvkiitdvheiyqcqpvadvvdiiqlpaflar
    qtdlveamaktgavinvkkpqflspsqmgnivekieecgndkiilcdrgtnfgydnlivd
    mlgfsvmkkaskgspvifdvthslqcrdpfgaassgrraqvtelarsglavgiaglflea
    hpnpnqakcdgpsalplsalegfvsqmkaiddlvksfpeldtsigshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o60D (D:)
    qnkivkignidvandkpfvlfggmnvlesrdmamqvceayvkvteklgvpyvfkasfdka
    nrssihsyrgpgmeeglkifqelkdtfgvkiitdvheiyqcqpvadvvdiiqlpaflarq
    tdlveamaktgavinvkkpqflspsqmgnivekieecgndkiilcdrgtnfgydnlivdm
    lgfsvmkkaskgspvifdvthslqraqvtelarsglavgiaglfleahpnpnqakcdgps
    alplsalegfvsqmkaiddlvksfpeldt