PDB entry 1o5z

View 1o5z on RCSB PDB site
Description: crystal structure of folylpolyglutamate synthase (tm0166) from thermotoga maritima at 2.10 a resolution
Deposited on 2003-10-10, released 2003-11-11
The last revision prior to the SCOP 1.67 freeze date was dated 2003-11-11, with a file datestamp of 2003-11-11.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.184
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o5zA (A:)
    mgsdkihhhhhhmaylevlrylyhkrpmgkvkpglerismllsklgnphleyktihiggt
    ngkgsvanmvsnilvsqgyrvgsyysphlstfrerirlneeyiseedvvkiyetmepiln
    eldkeeifspsffevvtamaflyfaeknvdiavlevglggrldatnvvfplcstivtvdr
    dhektlgytieqiaweksgiikervplvtgerkrealkvmedvarkkssrmyvidkdfsv
    kvkslklhenrfdycgentfedlvltmngphqienagvalktleatglplsekaireglk
    naknlgrfeilekngkmyildgahnphgaeslvrslklyfngeplslvigilddknredi
    lrkytgifervivtrvpsprmkdmnslvdmakkffknveviedpleaiesteratvvtgs
    lflvgyvreflttgkineewkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o5zA (A:)
    hhhmaylevlrylyhkvkpglerismllsklgnphleyktihiggtngkgsvanmvsnil
    vsqgyrvgsyysphlstfrerirlneeyiseedvvkiyetmepilneldkeeifspsffe
    vvtamaflyfaeknvdiavlevglggrldatnvvfplcstivtvdrytieqiaweksgii
    kervplvtgerkrealkvmedvarkkssrmyvidkdfsvkvkslklhenrfdycgentfe
    dlvltmngphqienagvalktleatglplsekaireglknaknlgrfeilekngkmyild
    gahnphgaeslvrslklyfngeplslvigilddknredilrkytgifervivtrvpsprm
    kdmnslvdmakkffknveviedpleaiesteratvvtgslflvgyvreflttgkineewk
    l