PDB entry 1o5y

View 1o5y on RCSB PDB site
Description: Crystal structure of hypothetical protein (TM0160) from Thermotoga maritima at 1.90 A resolution
Class: structural genomics, unknown function
Keywords: tm0160, hypothetical protein, structural genomics, jcsg
Deposited on 2003-10-08, released 2003-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2004-03-16, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.201
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein TM0160
    Species: Thermotoga maritima
    Gene: TM0160
    Database cross-references and differences (RAF-indexed):
    • GB NP_227975 (12-End)
      • leader sequence (11)
      • modified residue (12)
      • modified residue (58)
      • modified residue (61)
    Domains in SCOPe 2.07: d1o5ya1, d1o5ya2
  • Chain 'B':
    Compound: conserved hypothetical protein TM0160
    Species: Thermotoga maritima
    Gene: TM0160
    Database cross-references and differences (RAF-indexed):
    • GB NP_227975 (12-End)
      • leader sequence (11)
      • modified residue (12)
      • modified residue (58)
      • modified residue (61)
    Domains in SCOPe 2.07: d1o5yb1, d1o5yb2
  • Heterogens: CL, UNL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o5yA (A:)
    mgsdkihhhhhhmrkawvktlaldrvsntpvvilgiegtnrvlpiwigaceghalalame
    kmefprplthdlllsvleslearvdkviihslkdntfyatlvirdltytdeedeeaalid
    idsrpsdaiilavktgapifvsdnlvekhsielevnetqdeeeefkkfvenlnidtfkqm
    iekkreedeeges
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o5yA (A:)
    hmrkawvktlaldrvsntpvvilgiegtnrvlpiwigaceghalalamekmefprplthd
    lllsvleslearvdkviihslkdntfyatlvirdltaalididsrpsdaiilavktgapi
    fvsdnlvekhsielevnetqdee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o5yB (B:)
    mgsdkihhhhhhmrkawvktlaldrvsntpvvilgiegtnrvlpiwigaceghalalame
    kmefprplthdlllsvleslearvdkviihslkdntfyatlvirdltytdeedeeaalid
    idsrpsdaiilavktgapifvsdnlvekhsielevnetqdeeeefkkfvenlnidtfkqm
    iekkreedeeges
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o5yB (B:)
    hmrkawvktlaldrvsntpvvilgiegtnrvlpiwigaceghalalamekmefprplthd
    lllsvleslearvdkviihslkdntfyatlvirdltyeeaalididsrpsdaiilavktg
    apifvsdnlvekhsiel