PDB entry 1o5x

View 1o5x on RCSB PDB site
Description:
Deposited on 2003-10-06, released 2004-01-13
The last revision prior to the SCOP 1.67 freeze date was dated 2004-01-20, with a file datestamp of 2004-01-20.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.133
AEROSPACI score: 0.93 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1o5xa_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1o5xb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o5xA (A:)
    markyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfs
    tgiqnvskfgngsytgevsaeiakdlnieyviighferrkyfhetdedvreklqaslknn
    lkavvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeq
    aqlvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesf
    vdiiksam
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o5xA (A:)
    rkyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfstg
    iqnvskfgngsytgevsaeiakdlnieyviighferrkyfhetdedvreklqaslknnlk
    avvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeqaq
    lvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesfvd
    iiksam
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o5xB (B:)
    markyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfs
    tgiqnvskfgngsytgevsaeiakdlnieyviighferrkyfhetdedvreklqaslknn
    lkavvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeq
    aqlvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesf
    vdiiksam
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o5xB (B:)
    rkyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfstg
    iqnvskfgngsytgevsaeiakdlnieyviighferrkyfhetdedvreklqaslknnlk
    avvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeqaq
    lvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesfvd
    iiksam