PDB entry 1o5w

View 1o5w on RCSB PDB site
Description: The structure basis of specific recognitions for substrates and inhibitors of rat monoamine oxidase A
Deposited on 2003-10-06, released 2004-04-20
The last revision prior to the SCOP 1.69 freeze date was dated 2004-04-20, with a file datestamp of 2004-04-20.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.22
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o5wA (A:)
    mghhhhhhmtdlekpnlaghmfdvvvigggisglaaakllseykinvlvleardrvggrt
    ytvrnehvkwvdvggayvgptqnrilrlskelgietykvnvnerlvqyvkgktypfrgaf
    ppvwnplayldynnlwrtmdemgkeipvdapwqarhaqewdkmtmkdlidkicwtktare
    faylfvninvtsephevsalwflwyvrqcggtarifsvtnggqerkfvggsgqvseqimg
    llgdkvklsspvtyidqtddniivetlnhehyeckyvisaippiltakihfkpelppern
    qliqrlpmgavikcmvyykeafwkkkdycgcmiiedeeapiaitlddtkpdgslpaimgf
    ilarkadrlaklhkdirkrkicelyakvlgsqealypvhyeeknwceeqysggcytayfp
    pgimtqygrvirqpvgriyfagtetatqwsgymegaveageraarevlnalgkvakkdiw
    veepeskdvpaieithtflernlpsvpgllkitgvstsvallcfvlykikklpc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o5wA (A:)
    aghmfdvvvigggisglaaakllseykinvlvleardrvggrtytvrnehvkwvdvggay
    vgptqnrilrlskelgietykvnvnerlvqyvkgktypfrgafppvwnplayldynnlwr
    tmdemgkeipvdapwqarhaqewdkmtmkdlidkicwtktarefaylfvninvtsephev
    salwflwyvrqcggtarifsvtnggqerkfvggsgqvseqimgllgdkvklsspvtyidq
    tddniivetlnhehyeckyvisaippiltakihfkpelppernqliqrlpmgavikcmvy
    ykeafwkkkdycgcmiiedeeapiaitlddtkpdgslpaimgfilarkadrlaklhkdir
    krkicelyakvlgsqealypvhyeeknwceeqysggcytayfppgimtqygrvirqpvgr
    iyfagtetatqwsgymegaveageraarevlnalgkvakkdiwveepeskdvpaieitht
    flernlpsvpgllkitgvstsvallcfvlyk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o5wB (B:)
    mghhhhhhmtdlekpnlaghmfdvvvigggisglaaakllseykinvlvleardrvggrt
    ytvrnehvkwvdvggayvgptqnrilrlskelgietykvnvnerlvqyvkgktypfrgaf
    ppvwnplayldynnlwrtmdemgkeipvdapwqarhaqewdkmtmkdlidkicwtktare
    faylfvninvtsephevsalwflwyvrqcggtarifsvtnggqerkfvggsgqvseqimg
    llgdkvklsspvtyidqtddniivetlnhehyeckyvisaippiltakihfkpelppern
    qliqrlpmgavikcmvyykeafwkkkdycgcmiiedeeapiaitlddtkpdgslpaimgf
    ilarkadrlaklhkdirkrkicelyakvlgsqealypvhyeeknwceeqysggcytayfp
    pgimtqygrvirqpvgriyfagtetatqwsgymegaveageraarevlnalgkvakkdiw
    veepeskdvpaieithtflernlpsvpgllkitgvstsvallcfvlykikklpc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o5wB (B:)
    aghmfdvvvigggisglaaakllseykinvlvleardrvggrtytvrnehvkwvdvggay
    vgptqnrilrlskelgietykvnvnerlvqyvkgktypfrgafppvwnplayldynnlwr
    tmdemgkeipvdapwqarhaqewdkmtmkdlidkicwtktarefaylfvninvtsephev
    salwflwyvrqcggtarifsvtnggqerkfvggsgqvseqimgllgdkvklsspvtyidq
    tddniivetlnhehyeckyvisaippiltakihfkpelppernqliqrlpmgavikcmvy
    ykeafwkkkdycgcmiiedeeapiaitlddtkpdgslpaimgfilarkadrlaklhkdir
    krkicelyakvlgsqealypvhyeeknwceeqysggcytayfppgimtqygrvirqpvgr
    iyfagtetatqwsgymegaveageraarevlnalgkvakkdiwveepeskdvpaieitht
    flernlpsvpgllkitgvstsva
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1o5wC (C:)
    mghhhhhhmtdlekpnlaghmfdvvvigggisglaaakllseykinvlvleardrvggrt
    ytvrnehvkwvdvggayvgptqnrilrlskelgietykvnvnerlvqyvkgktypfrgaf
    ppvwnplayldynnlwrtmdemgkeipvdapwqarhaqewdkmtmkdlidkicwtktare
    faylfvninvtsephevsalwflwyvrqcggtarifsvtnggqerkfvggsgqvseqimg
    llgdkvklsspvtyidqtddniivetlnhehyeckyvisaippiltakihfkpelppern
    qliqrlpmgavikcmvyykeafwkkkdycgcmiiedeeapiaitlddtkpdgslpaimgf
    ilarkadrlaklhkdirkrkicelyakvlgsqealypvhyeeknwceeqysggcytayfp
    pgimtqygrvirqpvgriyfagtetatqwsgymegaveageraarevlnalgkvakkdiw
    veepeskdvpaieithtflernlpsvpgllkitgvstsvallcfvlykikklpc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o5wC (C:)
    aghmfdvvvigggisglaaakllseykinvlvleardrvggrtytvrnehvkwvdvggay
    vgptqnrilrlskelgietykvnvnerlvqyvkgktypfrgafppvwnplayldynnlwr
    tmdemgkeipvdapwqarhaqewdkmtmkdlidkicwtktarefaylfvninvtsephev
    salwflwyvrqcggtarifsvtnggqerkfvggsgqvseqimgllgdkvklsspvtyidq
    tddniivetlnhehyeckyvisaippiltakihfkpelppernqliqrlpmgavikcmvy
    ykeafwkkkdycgcmiiedeeapiaitlddtkpdgslpaimgfilarkadrlaklhkdir
    krkicelyakvlgsqealypvhyeeknwceeqysggcytayfppgimtqygrvirqpvgr
    iyfagtetatqwsgymegaveageraarevlnalgkvakkdiwveepeskdvpaieitht
    flernlpsvpgllkitgvstsvallcfvlyki
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1o5wD (D:)
    mghhhhhhmtdlekpnlaghmfdvvvigggisglaaakllseykinvlvleardrvggrt
    ytvrnehvkwvdvggayvgptqnrilrlskelgietykvnvnerlvqyvkgktypfrgaf
    ppvwnplayldynnlwrtmdemgkeipvdapwqarhaqewdkmtmkdlidkicwtktare
    faylfvninvtsephevsalwflwyvrqcggtarifsvtnggqerkfvggsgqvseqimg
    llgdkvklsspvtyidqtddniivetlnhehyeckyvisaippiltakihfkpelppern
    qliqrlpmgavikcmvyykeafwkkkdycgcmiiedeeapiaitlddtkpdgslpaimgf
    ilarkadrlaklhkdirkrkicelyakvlgsqealypvhyeeknwceeqysggcytayfp
    pgimtqygrvirqpvgriyfagtetatqwsgymegaveageraarevlnalgkvakkdiw
    veepeskdvpaieithtflernlpsvpgllkitgvstsvallcfvlykikklpc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o5wD (D:)
    aghmfdvvvigggisglaaakllseykinvlvleardrvggrtytvrnehvkwvdvggay
    vgptqnrilrlskelgietykvnvnerlvqyvkgktypfrgafppvwnplayldynnlwr
    tmdemgkeipvdapwqarhaqewdkmtmkdlidkicwtktarefaylfvninvtsephev
    salwflwyvrqcggtarifsvtnggqerkfvggsgqvseqimgllgdkvklsspvtyidq
    tddniivetlnhehyeckyvisaippiltakihfkpelppernqliqrlpmgavikcmvy
    ykeafwkkkdycgcmiiedeeapiaitlddtkpdgslpaimgfilarkadrlaklhkdir
    krkicelyakvlgsqealypvhyeeknwceeqysggcytayfppgimtqygrvirqpvgr
    iyfagtetatqwsgymegaveageraarevlnalgkvakkdiwveepeskdvpaieitht
    flernlpsvpgllkitgvstsvallc